Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2297093..2297737 | Replicon | chromosome |
Accession | NZ_CP116943 | ||
Organism | Providencia alcalifaciens strain 2939/90 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | B6XA97 |
Locus tag | PO864_RS10715 | Protein ID | WP_004905417.1 |
Coordinates | 2297093..2297296 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | PO864_RS10720 | Protein ID | WP_006662760.1 |
Coordinates | 2297369..2297737 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO864_RS10695 (PO864_10795) | 2292986..2294767 | + | 1782 | WP_036961890.1 | SmdB family multidrug efflux ABC transporter permease/ATP-binding protein | - |
PO864_RS10700 (PO864_10800) | 2294914..2295780 | - | 867 | WP_036961892.1 | acyl-CoA thioesterase II | - |
PO864_RS10705 | 2296187..2296396 | + | 210 | Protein_2081 | YbaY family lipoprotein | - |
PO864_RS10715 (PO864_10815) | 2297093..2297296 | - | 204 | WP_004905417.1 | HHA domain-containing protein | Toxin |
PO864_RS10720 (PO864_10820) | 2297369..2297737 | - | 369 | WP_006662760.1 | Hha toxicity modulator TomB | Antitoxin |
PO864_RS10725 (PO864_10825) | 2298263..2299642 | - | 1380 | WP_036961894.1 | murein transglycosylase D | - |
PO864_RS10730 (PO864_10830) | 2299698..2300477 | - | 780 | WP_282490042.1 | hydroxyacylglutathione hydrolase | - |
PO864_RS10735 (PO864_10835) | 2300514..2301239 | + | 726 | WP_006657235.1 | methyltransferase domain-containing protein | - |
PO864_RS10740 (PO864_10840) | 2301243..2301722 | - | 480 | WP_282490043.1 | ribonuclease HI | - |
PO864_RS10745 (PO864_10845) | 2301777..2302538 | + | 762 | WP_036961895.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8061.34 Da Isoelectric Point: 6.9770
>T269517 WP_004905417.1 NZ_CP116943:c2297296-2297093 [Providencia alcalifaciens]
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14087.96 Da Isoelectric Point: 4.4687
>AT269517 WP_006662760.1 NZ_CP116943:c2297737-2297369 [Providencia alcalifaciens]
MDEYSPKKHDIAELKYLCNSLNRDAISSLQKTNTHWINDLSSAQSISLNELVEHIAAFVWRFKIKYPKENLVISLVEEYL
DETYNLFGSPVVTFSEIIDWESMNQNLVAVLDDDLKCLTSKT
MDEYSPKKHDIAELKYLCNSLNRDAISSLQKTNTHWINDLSSAQSISLNELVEHIAAFVWRFKIKYPKENLVISLVEEYL
DETYNLFGSPVVTFSEIIDWESMNQNLVAVLDDDLKCLTSKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|