Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1436283..1437202 | Replicon | chromosome |
Accession | NZ_CP116941 | ||
Organism | Bacillus licheniformis strain GN02 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | T5HIF3 |
Locus tag | OSR41_RS07390 | Protein ID | WP_003180879.1 |
Coordinates | 1436456..1437202 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | T5HT37 |
Locus tag | OSR41_RS07385 | Protein ID | WP_003180877.1 |
Coordinates | 1436283..1436456 (-) | Length | 58 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSR41_RS07360 (OSR41_07360) | 1431708..1432805 | + | 1098 | WP_003180867.1 | mannonate dehydratase | - |
OSR41_RS07365 (OSR41_07365) | 1432781..1433629 | + | 849 | WP_009328728.1 | SDR family oxidoreductase | - |
OSR41_RS07370 (OSR41_07370) | 1433656..1434669 | + | 1014 | WP_003180872.1 | zinc-binding alcohol dehydrogenase family protein | - |
OSR41_RS07375 (OSR41_07375) | 1434722..1435993 | + | 1272 | WP_011197811.1 | MFS transporter | - |
OSR41_RS07380 (OSR41_07380) | 1436056..1436187 | - | 132 | WP_003180875.1 | hypothetical protein | - |
OSR41_RS07385 (OSR41_07385) | 1436283..1436456 | - | 174 | WP_003180877.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
OSR41_RS07390 (OSR41_07390) | 1436456..1437202 | - | 747 | WP_003180879.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
OSR41_RS07395 (OSR41_07395) | 1437313..1438311 | - | 999 | WP_009328723.1 | inorganic phosphate transporter | - |
OSR41_RS07400 (OSR41_07400) | 1438324..1438941 | - | 618 | WP_003180884.1 | DUF47 domain-containing protein | - |
OSR41_RS07405 (OSR41_07405) | 1439273..1441030 | + | 1758 | WP_003180886.1 | gamma-glutamyltransferase | - |
OSR41_RS07410 (OSR41_07410) | 1441159..1441803 | + | 645 | WP_009328721.1 | YesL family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29391.80 Da Isoelectric Point: 4.5367
>T269516 WP_003180879.1 NZ_CP116941:c1437202-1436456 [Bacillus licheniformis]
MLLFYQFLVWLIVLALALYVAAVWRFEKQLAEKTVAIRKTWYLLYVIGAVIYWTHDPQSIFTNPLHYLIVAVFFTLTDAF
IFLNAYFKKLGSSELATDTRMLLEENNDLLHTYQNRLKTFQYLLKNEPIHIYYGNIEAYAEGIEKLIKRFAEKMNISAAL
CEYNSEESKDHLLEHMENRFDVQEKLDRKDVYYEENGKMVLIPFSIHDFDYVMKLTSEDLVTEFDYLLFTSLTSIYDLLL
PNEEEGDD
MLLFYQFLVWLIVLALALYVAAVWRFEKQLAEKTVAIRKTWYLLYVIGAVIYWTHDPQSIFTNPLHYLIVAVFFTLTDAF
IFLNAYFKKLGSSELATDTRMLLEENNDLLHTYQNRLKTFQYLLKNEPIHIYYGNIEAYAEGIEKLIKRFAEKMNISAAL
CEYNSEESKDHLLEHMENRFDVQEKLDRKDVYYEENGKMVLIPFSIHDFDYVMKLTSEDLVTEFDYLLFTSLTSIYDLLL
PNEEEGDD
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|