Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 559284..559920 | Replicon | chromosome |
| Accession | NZ_CP116941 | ||
| Organism | Bacillus licheniformis strain GN02 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | M5P3Q9 |
| Locus tag | OSR41_RS02780 | Protein ID | WP_003179128.1 |
| Coordinates | 559570..559920 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | M5PDU2 |
| Locus tag | OSR41_RS02775 | Protein ID | WP_006638778.1 |
| Coordinates | 559284..559565 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSR41_RS02755 (OSR41_02755) | 554399..555880 | + | 1482 | WP_009330132.1 | PH domain-containing protein | - |
| OSR41_RS02760 (OSR41_02760) | 555877..556476 | - | 600 | WP_003179118.1 | rhomboid family intramembrane serine protease | - |
| OSR41_RS02765 (OSR41_02765) | 556819..557778 | + | 960 | WP_152847888.1 | outer membrane lipoprotein carrier protein LolA | - |
| OSR41_RS02770 (OSR41_02770) | 558003..559172 | + | 1170 | WP_026080763.1 | alanine racemase | - |
| OSR41_RS02775 (OSR41_02775) | 559284..559565 | + | 282 | WP_006638778.1 | hypothetical protein | Antitoxin |
| OSR41_RS02780 (OSR41_02780) | 559570..559920 | + | 351 | WP_003179128.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| OSR41_RS02785 (OSR41_02785) | 560038..560865 | + | 828 | WP_003179130.1 | RsbT co-antagonist protein RsbRA | - |
| OSR41_RS02790 (OSR41_02790) | 560869..561234 | + | 366 | WP_003179132.1 | STAS domain-containing protein | - |
| OSR41_RS02795 (OSR41_02795) | 561237..561638 | + | 402 | WP_003179135.1 | anti-sigma regulatory factor | - |
| OSR41_RS02800 (OSR41_02800) | 561649..562656 | + | 1008 | WP_003179137.1 | PP2C family protein-serine/threonine phosphatase | - |
| OSR41_RS02805 (OSR41_02805) | 562715..563041 | + | 327 | WP_003179140.1 | anti-sigma factor antagonist | - |
| OSR41_RS02810 (OSR41_02810) | 563041..563526 | + | 486 | WP_003179142.1 | anti-sigma B factor RsbW | - |
| OSR41_RS02815 (OSR41_02815) | 563492..564283 | + | 792 | WP_003179144.1 | RNA polymerase sigma factor SigB | - |
| OSR41_RS02820 (OSR41_02820) | 564280..564879 | + | 600 | WP_003179145.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12990.03 Da Isoelectric Point: 5.7234
>T269515 WP_003179128.1 NZ_CP116941:559570-559920 [Bacillus licheniformis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6I7FHI4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M5PDU2 |