Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 2598776..2599427 | Replicon | chromosome |
Accession | NZ_CP116932 | ||
Organism | Lacticaseibacillus rhamnosus GG |
Toxin (Protein)
Gene name | pemK | Uniprot ID | K8Q4Y0 |
Locus tag | PP652_RS12145 | Protein ID | WP_005686631.1 |
Coordinates | 2598776..2599159 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | K8QH19 |
Locus tag | PP652_RS12150 | Protein ID | WP_005686632.1 |
Coordinates | 2599179..2599427 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PP652_RS12140 (PP652_12140) | 2597812..2598339 | - | 528 | WP_005686630.1 | QueT transporter family protein | - |
PP652_RS12145 (PP652_12145) | 2598776..2599159 | - | 384 | WP_005686631.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PP652_RS12150 (PP652_12150) | 2599179..2599427 | - | 249 | WP_005686632.1 | antitoxin | Antitoxin |
PP652_RS12155 (PP652_12155) | 2599539..2600678 | - | 1140 | WP_005686633.1 | alanine racemase | - |
PP652_RS12160 (PP652_12160) | 2600665..2601039 | - | 375 | WP_005686634.1 | holo-ACP synthase | - |
PP652_RS12165 (PP652_12165) | 2601208..2602716 | - | 1509 | WP_005686635.1 | DEAD/DEAH box helicase | - |
PP652_RS12170 (PP652_12170) | 2602990..2604378 | - | 1389 | WP_015765066.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13757.03 Da Isoelectric Point: 10.9764
>T269514 WP_005686631.1 NZ_CP116932:c2599159-2598776 [Lacticaseibacillus rhamnosus GG]
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVSLPKPKTYNKN
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVSLPKPKTYNKN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|