Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4278024..4278856 Replicon chromosome
Accession NZ_CP116931
Organism Escherichia coli strain MLI106K1

Toxin (Protein)


Gene name yeeV Uniprot ID A7ZVJ9
Locus tag NL422_RS21160 Protein ID WP_000854765.1
Coordinates 4278024..4278398 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag NL422_RS21165 Protein ID WP_001295723.1
Coordinates 4278488..4278856 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL422_RS21130 (4274502) 4274502..4274651 - 150 Protein_4003 hypothetical protein -
NL422_RS21135 (4274757) 4274757..4274933 - 177 WP_001586605.1 DUF957 domain-containing protein -
NL422_RS21140 (4274950) 4274950..4275360 - 411 Protein_4005 DUF5983 family protein -
NL422_RS21145 (4275445) 4275445..4276191 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
NL422_RS21150 (4276206) 4276206..4277747 - 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
NL422_RS21155 (4277941) 4277941..4278027 - 87 Protein_4008 DUF5983 family protein -
NL422_RS21160 (4278024) 4278024..4278398 - 375 WP_000854765.1 TA system toxin CbtA family protein Toxin
NL422_RS21165 (4278488) 4278488..4278856 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NL422_RS21170 (4279019) 4279019..4279240 - 222 WP_000692345.1 DUF987 domain-containing protein -
NL422_RS21175 (4279309) 4279309..4279785 - 477 WP_001354275.1 RadC family protein -
NL422_RS21180 (4279801) 4279801..4280274 - 474 WP_001387789.1 antirestriction protein -
NL422_RS21185 (4280440) 4280440..4280613 - 174 WP_001183321.1 hypothetical protein -
NL422_RS21190 (4280613) 4280613..4281431 - 819 WP_072617192.1 DUF932 domain-containing protein -
NL422_RS21195 (4281549) 4281549..4281744 - 196 Protein_4016 DUF905 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13970.98 Da        Isoelectric Point: 7.2909

>T269511 WP_000854765.1 NZ_CP116931:c4278398-4278024 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT269511 WP_001295723.1 NZ_CP116931:c4278856-4278488 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZVJ9

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References