Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 3182693..3183398 | Replicon | chromosome |
| Accession | NZ_CP116931 | ||
| Organism | Escherichia coli strain MLI106K1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | NL422_RS16095 | Protein ID | WP_000539521.1 |
| Coordinates | 3182693..3183079 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NL422_RS16100 | Protein ID | WP_001280945.1 |
| Coordinates | 3183069..3183398 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL422_RS16075 (3178697) | 3178697..3179323 | + | 627 | WP_001595548.1 | glutathione S-transferase GstB | - |
| NL422_RS16080 (3179320) | 3179320..3180435 | - | 1116 | WP_001595547.1 | aldose sugar dehydrogenase YliI | - |
| NL422_RS16085 (3180546) | 3180546..3180929 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| NL422_RS16090 (3181142) | 3181142..3182467 | + | 1326 | WP_000049378.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| NL422_RS16095 (3182693) | 3182693..3183079 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL422_RS16100 (3183069) | 3183069..3183398 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| NL422_RS16105 (3183468) | 3183468..3184796 | - | 1329 | WP_049068068.1 | GGDEF domain-containing protein | - |
| NL422_RS16110 (3184804) | 3184804..3187152 | - | 2349 | WP_001328220.1 | EAL domain-containing protein | - |
| NL422_RS16115 (3187330) | 3187330..3188241 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T269506 WP_000539521.1 NZ_CP116931:3182693-3183079 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|