Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2928817..2929601 | Replicon | chromosome |
Accession | NZ_CP116931 | ||
Organism | Escherichia coli strain MLI106K1 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | NL422_RS14895 | Protein ID | WP_000613626.1 |
Coordinates | 2929107..2929601 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | NL422_RS14890 | Protein ID | WP_001110447.1 |
Coordinates | 2928817..2929110 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL422_RS14880 (2923967) | 2923967..2924926 | - | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
NL422_RS14885 (2925499) | 2925499..2928684 | + | 3186 | WP_001550951.1 | ribonuclease E | - |
NL422_RS14890 (2928817) | 2928817..2929110 | + | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
NL422_RS14895 (2929107) | 2929107..2929601 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
NL422_RS14900 (2929696) | 2929696..2930649 | - | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
NL422_RS14905 (2930661) | 2930661..2932304 | - | 1644 | WP_072617246.1 | flagellar hook-associated protein FlgK | - |
NL422_RS14910 (2932370) | 2932370..2933311 | - | 942 | WP_001366226.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
NL422_RS14915 (2933311) | 2933311..2934408 | - | 1098 | WP_001441925.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T269505 WP_000613626.1 NZ_CP116931:2929107-2929601 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|