Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2545320..2545958 | Replicon | chromosome |
| Accession | NZ_CP116931 | ||
| Organism | Escherichia coli strain MLI106K1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7U9DHD1 |
| Locus tag | NL422_RS12930 | Protein ID | WP_000813795.1 |
| Coordinates | 2545782..2545958 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NL422_RS12925 | Protein ID | WP_076797675.1 |
| Coordinates | 2545320..2545736 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL422_RS12905 (2540472) | 2540472..2541413 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| NL422_RS12910 (2541414) | 2541414..2542427 | - | 1014 | WP_001551095.1 | ABC transporter ATP-binding protein | - |
| NL422_RS12915 (2542445) | 2542445..2543590 | - | 1146 | WP_001551094.1 | ABC transporter substrate-binding protein | - |
| NL422_RS12920 (2543835) | 2543835..2545241 | - | 1407 | WP_001551093.1 | PLP-dependent aminotransferase family protein | - |
| NL422_RS12925 (2545320) | 2545320..2545736 | - | 417 | WP_076797675.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NL422_RS12930 (2545782) | 2545782..2545958 | - | 177 | WP_000813795.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NL422_RS12935 (2546180) | 2546180..2546410 | + | 231 | WP_023910283.1 | YncJ family protein | - |
| NL422_RS12940 (2546502) | 2546502..2548463 | - | 1962 | WP_001551090.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NL422_RS12945 (2548536) | 2548536..2549072 | - | 537 | WP_001551089.1 | DNA-binding transcriptional regulator SutR | - |
| NL422_RS12950 (2549125) | 2549125..2550336 | + | 1212 | WP_071591517.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6747.80 Da Isoelectric Point: 11.5666
>T269504 WP_000813795.1 NZ_CP116931:c2545958-2545782 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15220.55 Da Isoelectric Point: 4.7386
>AT269504 WP_076797675.1 NZ_CP116931:c2545736-2545320 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|