Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1908245..1909077 Replicon chromosome
Accession NZ_CP116931
Organism Escherichia coli strain MLI106K1

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1L4HFA4
Locus tag NL422_RS09750 Protein ID WP_032163901.1
Coordinates 1908245..1908619 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag NL422_RS09755 Protein ID WP_001295723.1
Coordinates 1908709..1909077 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL422_RS09710 (1903641) 1903641..1904807 + 1167 WP_042031746.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
NL422_RS09715 (1904926) 1904926..1905399 + 474 WP_001105415.1 DNA gyrase inhibitor SbmC -
NL422_RS09720 (1905597) 1905597..1906655 + 1059 WP_001200891.1 FUSC family protein -
NL422_RS09725 (1906827) 1906827..1907156 + 330 WP_000450409.1 DUF496 family protein -
NL422_RS09730 (1907257) 1907257..1907391 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
NL422_RS09735 (1907511) 1907511..1907639 + 129 Protein_1773 transposase domain-containing protein -
NL422_RS09740 (1907928) 1907928..1908008 - 81 Protein_1774 hypothetical protein -
NL422_RS09745 (1908054) 1908054..1908248 - 195 WP_000988600.1 DUF5983 family protein -
NL422_RS09750 (1908245) 1908245..1908619 - 375 WP_032163901.1 TA system toxin CbtA family protein Toxin
NL422_RS09755 (1908709) 1908709..1909077 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NL422_RS09760 (1909240) 1909240..1909461 - 222 WP_000692345.1 DUF987 domain-containing protein -
NL422_RS09765 (1909524) 1909524..1910000 - 477 WP_001186726.1 RadC family protein -
NL422_RS09770 (1910016) 1910016..1910501 - 486 WP_000849582.1 antirestriction protein -
NL422_RS09775 (1910556) 1910556..1911374 - 819 WP_040061766.1 DUF932 domain-containing protein -
NL422_RS09780 (1911474) 1911474..1911707 - 234 WP_001119729.1 DUF905 family protein -
NL422_RS09785 (1911786) 1911786..1912241 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13919.89 Da        Isoelectric Point: 7.7760

>T269498 WP_032163901.1 NZ_CP116931:c1908619-1908245 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT269498 WP_001295723.1 NZ_CP116931:c1909077-1908709 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1L4HFA4

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References