Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1908245..1909077 | Replicon | chromosome |
| Accession | NZ_CP116931 | ||
| Organism | Escherichia coli strain MLI106K1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1L4HFA4 |
| Locus tag | NL422_RS09750 | Protein ID | WP_032163901.1 |
| Coordinates | 1908245..1908619 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | NL422_RS09755 | Protein ID | WP_001295723.1 |
| Coordinates | 1908709..1909077 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL422_RS09710 (1903641) | 1903641..1904807 | + | 1167 | WP_042031746.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| NL422_RS09715 (1904926) | 1904926..1905399 | + | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| NL422_RS09720 (1905597) | 1905597..1906655 | + | 1059 | WP_001200891.1 | FUSC family protein | - |
| NL422_RS09725 (1906827) | 1906827..1907156 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| NL422_RS09730 (1907257) | 1907257..1907391 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| NL422_RS09735 (1907511) | 1907511..1907639 | + | 129 | Protein_1773 | transposase domain-containing protein | - |
| NL422_RS09740 (1907928) | 1907928..1908008 | - | 81 | Protein_1774 | hypothetical protein | - |
| NL422_RS09745 (1908054) | 1908054..1908248 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
| NL422_RS09750 (1908245) | 1908245..1908619 | - | 375 | WP_032163901.1 | TA system toxin CbtA family protein | Toxin |
| NL422_RS09755 (1908709) | 1908709..1909077 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NL422_RS09760 (1909240) | 1909240..1909461 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NL422_RS09765 (1909524) | 1909524..1910000 | - | 477 | WP_001186726.1 | RadC family protein | - |
| NL422_RS09770 (1910016) | 1910016..1910501 | - | 486 | WP_000849582.1 | antirestriction protein | - |
| NL422_RS09775 (1910556) | 1910556..1911374 | - | 819 | WP_040061766.1 | DUF932 domain-containing protein | - |
| NL422_RS09780 (1911474) | 1911474..1911707 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| NL422_RS09785 (1911786) | 1911786..1912241 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13919.89 Da Isoelectric Point: 7.7760
>T269498 WP_032163901.1 NZ_CP116931:c1908619-1908245 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT269498 WP_001295723.1 NZ_CP116931:c1909077-1908709 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1L4HFA4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |