Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 910339..910993 | Replicon | chromosome |
Accession | NZ_CP116931 | ||
Organism | Escherichia coli strain MLI106K1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | NL422_RS05030 | Protein ID | WP_000244781.1 |
Coordinates | 910586..910993 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NL422_RS05025 | Protein ID | WP_000354046.1 |
Coordinates | 910339..910605 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL422_RS05005 (906427) | 906427..907860 | - | 1434 | WP_001389468.1 | 6-phospho-beta-glucosidase BglA | - |
NL422_RS05010 (907905) | 907905..908216 | + | 312 | WP_001598596.1 | N(4)-acetylcytidine aminohydrolase | - |
NL422_RS05015 (908380) | 908380..909039 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
NL422_RS05020 (909116) | 909116..910096 | - | 981 | WP_001562036.1 | tRNA-modifying protein YgfZ | - |
NL422_RS05025 (910339) | 910339..910605 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NL422_RS05030 (910586) | 910586..910993 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
NL422_RS05035 (911033) | 911033..911554 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
NL422_RS05040 (911666) | 911666..912562 | + | 897 | WP_000806652.1 | site-specific tyrosine recombinase XerD | - |
NL422_RS05045 (912587) | 912587..913297 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NL422_RS05050 (913303) | 913303..915036 | + | 1734 | WP_001598594.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T269494 WP_000244781.1 NZ_CP116931:910586-910993 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|