Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 57839..58440 Replicon plasmid p121_MLI106-1
Accession NZ_CP116930
Organism Escherichia coli strain MLI106K1

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag NL422_RS00320 Protein ID WP_001216034.1
Coordinates 57839..58219 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NL422_RS00325 Protein ID WP_001190712.1
Coordinates 58219..58440 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL422_RS00285 (NL422_000285) 52890..53822 - 933 WP_000081352.1 homocysteine S-methyltransferase -
NL422_RS00290 (NL422_000290) 53809..55212 - 1404 WP_001373486.1 S-methylmethionine permease -
NL422_RS00295 (NL422_000295) 55456..56436 + 981 Protein_58 IS5-like element IS5 family transposase -
NL422_RS00300 (NL422_000300) 56646..56981 + 336 WP_169329198.1 type I deoxyribonuclease HsdR -
NL422_RS00305 (NL422_000305) 56931..57344 - 414 Protein_60 integrase core domain-containing protein -
NL422_RS00310 (NL422_000310) 57349..57627 - 279 Protein_61 pdcB -
NL422_RS00315 (NL422_000315) 57655..57834 - 180 WP_001513661.1 hypothetical protein -
NL422_RS00320 (NL422_000320) 57839..58219 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NL422_RS00325 (NL422_000325) 58219..58440 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NL422_RS00330 (NL422_000330) 58703..59400 + 698 WP_226458177.1 IS1-like element IS1A family transposase -
NL422_RS00335 (NL422_000335) 59587..59880 - 294 WP_226438991.1 biofilm development regulator YmgB/AriR family protein -
NL422_RS00340 (NL422_000340) 60184..60288 - 105 Protein_67 IS3 family transposase -
NL422_RS00345 (NL422_000345) 60315..60464 - 150 Protein_68 IS3 family transposase -
NL422_RS00355 (NL422_000355) 61678..62292 + 615 WP_032214276.1 acid-sensing system DNA-binding response regulator EvgA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrA14 / qnrS1 / blaCTX-M-15 / blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 - 1..121841 121841
- inside IScluster/Tn - - 50856..61002 10146


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T269492 WP_001216034.1 NZ_CP116930:c58219-57839 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT269492 WP_001190712.1 NZ_CP116930:c58440-58219 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References