Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3935047..3935879 Replicon chromosome
Accession NZ_CP116929
Organism Escherichia coli strain MLI105

Toxin (Protein)


Gene name yeeV Uniprot ID A7ZVJ9
Locus tag NL421_RS19415 Protein ID WP_000854765.1
Coordinates 3935047..3935421 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag NL421_RS19420 Protein ID WP_001295723.1
Coordinates 3935511..3935879 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL421_RS19385 (3931525) 3931525..3931674 - 150 Protein_3756 hypothetical protein -
NL421_RS19390 (3931780) 3931780..3931956 - 177 WP_001586605.1 DUF957 domain-containing protein -
NL421_RS19395 (3931973) 3931973..3932383 - 411 Protein_3758 DUF5983 family protein -
NL421_RS19400 (3932468) 3932468..3933214 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
NL421_RS19405 (3933229) 3933229..3934770 - 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
NL421_RS19410 (3934964) 3934964..3935050 - 87 Protein_3761 DUF5983 family protein -
NL421_RS19415 (3935047) 3935047..3935421 - 375 WP_000854765.1 TA system toxin CbtA family protein Toxin
NL421_RS19420 (3935511) 3935511..3935879 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NL421_RS19425 (3936042) 3936042..3936263 - 222 WP_000692345.1 DUF987 domain-containing protein -
NL421_RS19430 (3936332) 3936332..3936622 - 291 Protein_3765 JAB domain-containing protein -
NL421_RS19435 (3936668) 3936668..3937186 - 519 Protein_3766 hypothetical protein -
NL421_RS19440 (3937468) 3937468..3937599 + 132 Protein_3767 IS3 family transposase -
NL421_RS19445 (3937911) 3937911..3938608 + 698 WP_103215986.1 IS1-like element IS1A family transposase -
NL421_RS19450 (3938714) 3938714..3939007 - 294 WP_000239862.1 biofilm development regulator YmgB/AriR family protein -
NL421_RS19455 (3939309) 3939309..3939413 - 105 Protein_3770 IS3 family transposase -
NL421_RS19460 (3939440) 3939440..3939589 - 150 Protein_3771 IS3 family transposase -
NL421_RS19465 (3939651) 3939651..3939720 + 70 Protein_3772 hypothetical protein -
NL421_RS19470 (3939731) 3939731..3940428 - 698 Protein_3773 IS1 family transposase -
NL421_RS19475 (3940515) 3940515..3940583 - 69 WP_211180522.1 protein YkiE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 3932468..3939940 7472


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13970.98 Da        Isoelectric Point: 7.2909

>T269490 WP_000854765.1 NZ_CP116929:c3935421-3935047 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT269490 WP_001295723.1 NZ_CP116929:c3935879-3935511 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZVJ9

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References