Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2330287..2330925 | Replicon | chromosome |
Accession | NZ_CP116929 | ||
Organism | Escherichia coli strain MLI105 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
Locus tag | NL421_RS11545 | Protein ID | WP_001447010.1 |
Coordinates | 2330749..2330925 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NL421_RS11540 | Protein ID | WP_001270286.1 |
Coordinates | 2330287..2330703 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL421_RS11520 (2325439) | 2325439..2326380 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
NL421_RS11525 (2326381) | 2326381..2327394 | - | 1014 | WP_047654399.1 | ABC transporter ATP-binding protein | - |
NL421_RS11530 (2327412) | 2327412..2328557 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
NL421_RS11535 (2328802) | 2328802..2330208 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
NL421_RS11540 (2330287) | 2330287..2330703 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NL421_RS11545 (2330749) | 2330749..2330925 | - | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NL421_RS11550 (2331147) | 2331147..2331377 | + | 231 | WP_000494244.1 | YncJ family protein | - |
NL421_RS11555 (2331469) | 2331469..2333430 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NL421_RS11560 (2333503) | 2333503..2334039 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
NL421_RS11565 (2334131) | 2334131..2335306 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T269485 WP_001447010.1 NZ_CP116929:c2330925-2330749 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT269485 WP_001270286.1 NZ_CP116929:c2330703-2330287 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|