Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1733966..1734801 | Replicon | chromosome |
| Accession | NZ_CP116929 | ||
| Organism | Escherichia coli strain MLI105 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1X9TM58 |
| Locus tag | NL421_RS08470 | Protein ID | WP_000854761.1 |
| Coordinates | 1733966..1734343 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | NL421_RS08475 | Protein ID | WP_001295723.1 |
| Coordinates | 1734433..1734801 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL421_RS08430 (1729355) | 1729355..1729720 | - | 366 | WP_001282181.1 | EutP/PduV family microcompartment system protein | - |
| NL421_RS08435 (1729991) | 1729991..1730362 | - | 372 | WP_001295631.1 | IS110 family transposase | - |
| NL421_RS08440 (1730569) | 1730569..1730793 | - | 225 | Protein_1618 | transposase | - |
| NL421_RS08445 (1730874) | 1730874..1731278 | + | 405 | WP_000839179.1 | transposase | - |
| NL421_RS08450 (1731275) | 1731275..1731622 | + | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NL421_RS08455 (1731671) | 1731671..1733210 | + | 1540 | Protein_1621 | IS66-like element ISEc22 family transposase | - |
| NL421_RS08460 (1733641) | 1733641..1733721 | - | 81 | Protein_1622 | hypothetical protein | - |
| NL421_RS08465 (1733821) | 1733821..1733969 | - | 149 | Protein_1623 | DUF5983 family protein | - |
| NL421_RS08470 (1733966) | 1733966..1734343 | - | 378 | WP_000854761.1 | TA system toxin CbtA family protein | Toxin |
| NL421_RS08475 (1734433) | 1734433..1734801 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NL421_RS08480 (1734964) | 1734964..1735185 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NL421_RS08485 (1735254) | 1735254..1735730 | - | 477 | WP_122994424.1 | RadC family protein | - |
| NL421_RS08490 (1735745) | 1735745..1736218 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| NL421_RS08495 (1736560) | 1736560..1737345 | - | 786 | WP_114427785.1 | DUF932 domain-containing protein | - |
| NL421_RS08500 (1737526) | 1737526..1739067 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 1730874..1739828 | 8954 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14205.25 Da Isoelectric Point: 7.3249
>T269478 WP_000854761.1 NZ_CP116929:c1734343-1733966 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT269478 WP_001295723.1 NZ_CP116929:c1734801-1734433 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1X9TM58 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |