Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1733966..1734801 Replicon chromosome
Accession NZ_CP116929
Organism Escherichia coli strain MLI105

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1X9TM58
Locus tag NL421_RS08470 Protein ID WP_000854761.1
Coordinates 1733966..1734343 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag NL421_RS08475 Protein ID WP_001295723.1
Coordinates 1734433..1734801 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL421_RS08430 (1729355) 1729355..1729720 - 366 WP_001282181.1 EutP/PduV family microcompartment system protein -
NL421_RS08435 (1729991) 1729991..1730362 - 372 WP_001295631.1 IS110 family transposase -
NL421_RS08440 (1730569) 1730569..1730793 - 225 Protein_1618 transposase -
NL421_RS08445 (1730874) 1730874..1731278 + 405 WP_000839179.1 transposase -
NL421_RS08450 (1731275) 1731275..1731622 + 348 WP_000612626.1 IS66 family insertion sequence element accessory protein TnpB -
NL421_RS08455 (1731671) 1731671..1733210 + 1540 Protein_1621 IS66-like element ISEc22 family transposase -
NL421_RS08460 (1733641) 1733641..1733721 - 81 Protein_1622 hypothetical protein -
NL421_RS08465 (1733821) 1733821..1733969 - 149 Protein_1623 DUF5983 family protein -
NL421_RS08470 (1733966) 1733966..1734343 - 378 WP_000854761.1 TA system toxin CbtA family protein Toxin
NL421_RS08475 (1734433) 1734433..1734801 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NL421_RS08480 (1734964) 1734964..1735185 - 222 WP_000692345.1 DUF987 domain-containing protein -
NL421_RS08485 (1735254) 1735254..1735730 - 477 WP_122994424.1 RadC family protein -
NL421_RS08490 (1735745) 1735745..1736218 - 474 WP_000855059.1 antirestriction protein -
NL421_RS08495 (1736560) 1736560..1737345 - 786 WP_114427785.1 DUF932 domain-containing protein -
NL421_RS08500 (1737526) 1737526..1739067 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 1730874..1739828 8954


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14205.25 Da        Isoelectric Point: 7.3249

>T269478 WP_000854761.1 NZ_CP116929:c1734343-1733966 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT269478 WP_001295723.1 NZ_CP116929:c1734801-1734433 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X9TM58

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References