Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3619836..3620454 | Replicon | chromosome |
| Accession | NZ_CP116925 | ||
| Organism | Escherichia coli strain MLI104K2 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NL420_RS18655 | Protein ID | WP_001291435.1 |
| Coordinates | 3620236..3620454 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NL420_RS18650 | Protein ID | WP_000344800.1 |
| Coordinates | 3619836..3620210 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL420_RS18640 (3614925) | 3614925..3616118 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NL420_RS18645 (3616141) | 3616141..3619290 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| NL420_RS18650 (3619836) | 3619836..3620210 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NL420_RS18655 (3620236) | 3620236..3620454 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NL420_RS18660 (3620626) | 3620626..3621177 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| NL420_RS18665 (3621293) | 3621293..3621763 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| NL420_RS18670 (3621927) | 3621927..3623477 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NL420_RS18675 (3623519) | 3623519..3623872 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| NL420_RS18685 (3624251) | 3624251..3624562 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| NL420_RS18690 (3624593) | 3624593..3625165 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T269467 WP_001291435.1 NZ_CP116925:3620236-3620454 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT269467 WP_000344800.1 NZ_CP116925:3619836-3620210 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |