Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1816876..1817708 Replicon chromosome
Accession NZ_CP116925
Organism Escherichia coli strain MLI104K2

Toxin (Protein)


Gene name yeeV Uniprot ID A7ZVJ9
Locus tag NL420_RS09435 Protein ID WP_000854765.1
Coordinates 1816876..1817250 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag NL420_RS09440 Protein ID WP_001295723.1
Coordinates 1817340..1817708 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL420_RS09385 (1812185) 1812185..1812361 - 177 Protein_1733 IS21 family transposase -
NL420_RS09390 (1812312) 1812312..1812551 - 240 WP_272782055.1 hypothetical protein -
NL420_RS09395 (1812604) 1812604..1812822 - 219 WP_272782056.1 hypothetical protein -
NL420_RS09400 (1814048) 1814048..1814272 - 225 WP_272782057.1 hypothetical protein -
NL420_RS09405 (1814287) 1814287..1814772 - 486 WP_272782058.1 hypothetical protein -
NL420_RS09410 (1814786) 1814786..1815007 - 222 WP_272782059.1 hypothetical protein -
NL420_RS09415 (1815032) 1815032..1815370 - 339 WP_272782060.1 hypothetical protein -
NL420_RS09420 (1815561) 1815561..1815698 - 138 WP_272782061.1 hypothetical protein -
NL420_RS09425 (1816547) 1816547..1816627 - 81 Protein_1741 hypothetical protein -
NL420_RS09430 (1816727) 1816727..1816879 - 153 Protein_1742 DUF5983 family protein -
NL420_RS09435 (1816876) 1816876..1817250 - 375 WP_000854765.1 TA system toxin CbtA family protein Toxin
NL420_RS09440 (1817340) 1817340..1817708 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NL420_RS09445 (1817871) 1817871..1818092 - 222 WP_000692345.1 DUF987 domain-containing protein -
NL420_RS09450 (1818155) 1818155..1818631 - 477 WP_001186774.1 RadC family protein -
NL420_RS09455 (1818647) 1818647..1819126 - 480 WP_000860074.1 antirestriction protein -
NL420_RS09460 (1819208) 1819208..1820029 - 822 WP_001234530.1 DUF932 domain-containing protein -
NL420_RS09465 (1820250) 1820250..1820660 - 411 WP_000846713.1 hypothetical protein -
NL420_RS09470 (1820676) 1820676..1821358 - 683 Protein_1750 hypothetical protein -
NL420_RS09475 (1821488) 1821488..1821814 - 327 Protein_1751 IS4 family transposase -
NL420_RS09480 (1822066) 1822066..1822476 - 411 Protein_1752 GTPase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13970.98 Da        Isoelectric Point: 7.2909

>T269459 WP_000854765.1 NZ_CP116925:c1817250-1816876 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT269459 WP_001295723.1 NZ_CP116925:c1817708-1817340 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZVJ9

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References