Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1816876..1817708 | Replicon | chromosome |
| Accession | NZ_CP116925 | ||
| Organism | Escherichia coli strain MLI104K2 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZVJ9 |
| Locus tag | NL420_RS09435 | Protein ID | WP_000854765.1 |
| Coordinates | 1816876..1817250 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | NL420_RS09440 | Protein ID | WP_001295723.1 |
| Coordinates | 1817340..1817708 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL420_RS09385 (1812185) | 1812185..1812361 | - | 177 | Protein_1733 | IS21 family transposase | - |
| NL420_RS09390 (1812312) | 1812312..1812551 | - | 240 | WP_272782055.1 | hypothetical protein | - |
| NL420_RS09395 (1812604) | 1812604..1812822 | - | 219 | WP_272782056.1 | hypothetical protein | - |
| NL420_RS09400 (1814048) | 1814048..1814272 | - | 225 | WP_272782057.1 | hypothetical protein | - |
| NL420_RS09405 (1814287) | 1814287..1814772 | - | 486 | WP_272782058.1 | hypothetical protein | - |
| NL420_RS09410 (1814786) | 1814786..1815007 | - | 222 | WP_272782059.1 | hypothetical protein | - |
| NL420_RS09415 (1815032) | 1815032..1815370 | - | 339 | WP_272782060.1 | hypothetical protein | - |
| NL420_RS09420 (1815561) | 1815561..1815698 | - | 138 | WP_272782061.1 | hypothetical protein | - |
| NL420_RS09425 (1816547) | 1816547..1816627 | - | 81 | Protein_1741 | hypothetical protein | - |
| NL420_RS09430 (1816727) | 1816727..1816879 | - | 153 | Protein_1742 | DUF5983 family protein | - |
| NL420_RS09435 (1816876) | 1816876..1817250 | - | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
| NL420_RS09440 (1817340) | 1817340..1817708 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NL420_RS09445 (1817871) | 1817871..1818092 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NL420_RS09450 (1818155) | 1818155..1818631 | - | 477 | WP_001186774.1 | RadC family protein | - |
| NL420_RS09455 (1818647) | 1818647..1819126 | - | 480 | WP_000860074.1 | antirestriction protein | - |
| NL420_RS09460 (1819208) | 1819208..1820029 | - | 822 | WP_001234530.1 | DUF932 domain-containing protein | - |
| NL420_RS09465 (1820250) | 1820250..1820660 | - | 411 | WP_000846713.1 | hypothetical protein | - |
| NL420_RS09470 (1820676) | 1820676..1821358 | - | 683 | Protein_1750 | hypothetical protein | - |
| NL420_RS09475 (1821488) | 1821488..1821814 | - | 327 | Protein_1751 | IS4 family transposase | - |
| NL420_RS09480 (1822066) | 1822066..1822476 | - | 411 | Protein_1752 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T269459 WP_000854765.1 NZ_CP116925:c1817250-1816876 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT269459 WP_001295723.1 NZ_CP116925:c1817708-1817340 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|