Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1022918..1023501 | Replicon | chromosome |
Accession | NZ_CP116925 | ||
Organism | Escherichia coli strain MLI104K2 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | NL420_RS05605 | Protein ID | WP_000254738.1 |
Coordinates | 1023166..1023501 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | NL420_RS05600 | Protein ID | WP_000581937.1 |
Coordinates | 1022918..1023166 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL420_RS05590 (1019257) | 1019257..1020558 | + | 1302 | WP_001556187.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
NL420_RS05595 (1020606) | 1020606..1022840 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
NL420_RS05600 (1022918) | 1022918..1023166 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NL420_RS05605 (1023166) | 1023166..1023501 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
NL420_RS05610 (1023572) | 1023572..1024363 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
NL420_RS05615 (1024591) | 1024591..1026228 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
NL420_RS05620 (1026316) | 1026316..1027614 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T269457 WP_000254738.1 NZ_CP116925:1023166-1023501 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|