Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 740009..740844 | Replicon | chromosome |
| Accession | NZ_CP116925 | ||
| Organism | Escherichia coli strain MLI104K2 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7W4PV54 |
| Locus tag | NL420_RS04190 | Protein ID | WP_000854821.1 |
| Coordinates | 740009..740386 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MK11 |
| Locus tag | NL420_RS04195 | Protein ID | WP_001285610.1 |
| Coordinates | 740476..740844 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL420_RS04165 (736398) | 736398..737801 | + | 1404 | Protein_713 | inorganic phosphate transporter PitB | - |
| NL420_RS04170 (737845) | 737845..738381 | + | 537 | WP_000942785.1 | GspM family type II secretion system protein YghD | - |
| NL420_RS04175 (738663) | 738663..739505 | - | 843 | WP_255123414.1 | DUF4942 domain-containing protein | - |
| NL420_RS04180 (739590) | 739590..739787 | - | 198 | WP_085949090.1 | DUF957 domain-containing protein | - |
| NL420_RS04185 (739815) | 739815..740012 | - | 198 | Protein_717 | DUF5983 family protein | - |
| NL420_RS04190 (740009) | 740009..740386 | - | 378 | WP_000854821.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| NL420_RS04195 (740476) | 740476..740844 | - | 369 | WP_001285610.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NL420_RS04200 (740924) | 740924..741145 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| NL420_RS04205 (741232) | 741232..741708 | - | 477 | WP_001318130.1 | RadC family protein | - |
| NL420_RS04210 (741723) | 741723..741893 | - | 171 | Protein_722 | antirestriction protein | - |
| NL420_RS04215 (741895) | 741895..744377 | - | 2483 | Protein_723 | AIDA repeat-containing protein | - |
| NL420_RS04220 (744711) | 744711..745583 | - | 873 | WP_001069668.1 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13930.95 Da Isoelectric Point: 8.5163
>T269455 WP_000854821.1 NZ_CP116925:c740386-740009 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13606.39 Da Isoelectric Point: 6.0618
>AT269455 WP_001285610.1 NZ_CP116925:c740844-740476 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|