Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 3669075..3669754 | Replicon | chromosome |
Accession | NZ_CP116923 | ||
Organism | Escherichia coli strain MLI104K1 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | S1FHS4 |
Locus tag | NL419_RS18655 | Protein ID | WP_000854680.1 |
Coordinates | 3669413..3669754 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | - |
Locus tag | NL419_RS18650 | Protein ID | WP_097463457.1 |
Coordinates | 3669075..3669392 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL419_RS18605 (3664513) | 3664513..3665334 | + | 822 | WP_032200808.1 | DUF932 domain-containing protein | - |
NL419_RS18610 (3665551) | 3665551..3666252 | + | 702 | WP_001581462.1 | WYL domain-containing protein | - |
NL419_RS18615 (3666293) | 3666293..3666529 | + | 237 | WP_001144031.1 | protein YpjK | - |
NL419_RS18620 (3666529) | 3666529..3666972 | + | 444 | WP_032199444.1 | lipoprotein YafY | - |
NL419_RS18625 (3666995) | 3666995..3667462 | + | 468 | WP_032200803.1 | protein YkfB | - |
NL419_RS18630 (3667539) | 3667539..3667778 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
NL419_RS18635 (3667876) | 3667876..3668334 | + | 459 | WP_032177818.1 | antirestriction protein | - |
NL419_RS18640 (3668350) | 3668350..3668826 | + | 477 | WP_072667534.1 | RadC family protein | - |
NL419_RS18645 (3668835) | 3668835..3669056 | + | 222 | WP_063928002.1 | DUF987 domain-containing protein | - |
NL419_RS18650 (3669075) | 3669075..3669392 | + | 318 | WP_097463457.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NL419_RS18655 (3669413) | 3669413..3669754 | + | 342 | WP_000854680.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
NL419_RS18660 (3670417) | 3670417..3670629 | + | 213 | Protein_3560 | integrase core domain-containing protein | - |
NL419_RS18665 (3670671) | 3670671..3671414 | - | 744 | WP_032170462.1 | AraC family transcriptional regulator | - |
NL419_RS18675 (3672675) | 3672675..3672962 | - | 288 | Protein_3563 | hypothetical protein | - |
NL419_RS18680 (3673124) | 3673124..3673180 | + | 57 | WP_211180520.1 | protein YsgD | - |
NL419_RS18685 (3673332) | 3673332..3674282 | + | 951 | WP_000947148.1 | magnesium/cobalt transporter CorA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3667876..3712539 | 44663 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12892.95 Da Isoelectric Point: 9.6543
>T269443 WP_000854680.1 NZ_CP116923:3669413-3669754 [Escherichia coli]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|