Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3475387..3476005 | Replicon | chromosome |
| Accession | NZ_CP116923 | ||
| Organism | Escherichia coli strain MLI104K1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NL419_RS17680 | Protein ID | WP_001291435.1 |
| Coordinates | 3475787..3476005 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NL419_RS17675 | Protein ID | WP_000344800.1 |
| Coordinates | 3475387..3475761 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL419_RS17665 (3470476) | 3470476..3471669 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NL419_RS17670 (3471692) | 3471692..3474841 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| NL419_RS17675 (3475387) | 3475387..3475761 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NL419_RS17680 (3475787) | 3475787..3476005 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NL419_RS17685 (3476177) | 3476177..3476728 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| NL419_RS17690 (3476844) | 3476844..3477314 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| NL419_RS17695 (3477478) | 3477478..3479028 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NL419_RS17700 (3479070) | 3479070..3479423 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| NL419_RS17710 (3479802) | 3479802..3480113 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| NL419_RS17715 (3480144) | 3480144..3480716 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T269442 WP_001291435.1 NZ_CP116923:3475787-3476005 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT269442 WP_000344800.1 NZ_CP116923:3475387-3475761 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |