Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1791771..1792603 Replicon chromosome
Accession NZ_CP116923
Organism Escherichia coli strain MLI104K1

Toxin (Protein)


Gene name yeeV Uniprot ID A7ZVJ9
Locus tag NL419_RS09060 Protein ID WP_000854765.1
Coordinates 1791771..1792145 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag NL419_RS09065 Protein ID WP_001295723.1
Coordinates 1792235..1792603 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL419_RS09030 (1787669) 1787669..1788040 - 372 WP_001445978.1 IS110 family transposase -
NL419_RS09035 (1788184) 1788184..1788682 - 499 Protein_1674 transposase -
NL419_RS09040 (1788876) 1788876..1790417 + 1542 WP_001445980.1 IS21-like element ISEc12 family transposase -
NL419_RS09045 (1790432) 1790432..1791178 + 747 Protein_1676 IS21-like element ISEc12 family helper ATPase IstB -
NL419_RS09050 (1791442) 1791442..1791522 - 81 Protein_1677 hypothetical protein -
NL419_RS09055 (1791622) 1791622..1791774 - 153 Protein_1678 DUF5983 family protein -
NL419_RS09060 (1791771) 1791771..1792145 - 375 WP_000854765.1 TA system toxin CbtA family protein Toxin
NL419_RS09065 (1792235) 1792235..1792603 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NL419_RS09070 (1792766) 1792766..1792987 - 222 WP_000692345.1 DUF987 domain-containing protein -
NL419_RS09075 (1793050) 1793050..1793526 - 477 WP_001186774.1 RadC family protein -
NL419_RS09080 (1793542) 1793542..1793826 - 285 Protein_1683 antirestriction protein -
NL419_RS09085 (1793892) 1793892..1794902 + 1011 Protein_1684 IS3 family transposase -
NL419_RS09090 (1795680) 1795680..1795844 + 165 WP_001128468.1 hypothetical protein -
NL419_RS09095 (1795817) 1795817..1796005 + 189 Protein_1686 IS4 family transposase -
NL419_RS09100 (1796002) 1796002..1796175 + 174 Protein_1687 cobalamin biosynthesis protein -
NL419_RS09105 (1796309) 1796309..1796854 + 546 WP_000973159.1 bifunctional adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase -
NL419_RS09110 (1796851) 1796851..1797594 + 744 WP_001297350.1 adenosylcobinamide-GDP ribazoletransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 1785530..1794910 9380


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13970.98 Da        Isoelectric Point: 7.2909

>T269434 WP_000854765.1 NZ_CP116923:c1792145-1791771 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT269434 WP_001295723.1 NZ_CP116923:c1792603-1792235 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZVJ9

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References