Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 979378..980032 | Replicon | chromosome |
| Accession | NZ_CP116919 | ||
| Organism | Escherichia coli strain MLI102 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | NL418_RS05495 | Protein ID | WP_000244781.1 |
| Coordinates | 979625..980032 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A0V9GG32 |
| Locus tag | NL418_RS05490 | Protein ID | WP_001564007.1 |
| Coordinates | 979378..979644 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL418_RS05470 (975466) | 975466..976899 | - | 1434 | WP_001564009.1 | 6-phospho-beta-glucosidase BglA | - |
| NL418_RS05475 (976944) | 976944..977255 | + | 312 | WP_001182966.1 | N(4)-acetylcytidine aminohydrolase | - |
| NL418_RS05480 (977419) | 977419..978078 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| NL418_RS05485 (978155) | 978155..979135 | - | 981 | WP_001564008.1 | tRNA-modifying protein YgfZ | - |
| NL418_RS05490 (979378) | 979378..979644 | + | 267 | WP_001564007.1 | FAD assembly factor SdhE | Antitoxin |
| NL418_RS05495 (979625) | 979625..980032 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| NL418_RS05500 (980072) | 980072..980593 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NL418_RS05505 (980705) | 980705..981601 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NL418_RS05510 (981626) | 981626..982336 | + | 711 | WP_001564005.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NL418_RS05515 (982342) | 982342..984075 | + | 1734 | WP_001564004.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T269414 WP_000244781.1 NZ_CP116919:979625-980032 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1PAM6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9GG32 |