Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3397838..3398456 | Replicon | chromosome |
Accession | NZ_CP116913 | ||
Organism | Escherichia coli strain MLI023K1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NL406_RS17405 | Protein ID | WP_001291435.1 |
Coordinates | 3398238..3398456 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NL406_RS17400 | Protein ID | WP_000344800.1 |
Coordinates | 3397838..3398212 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL406_RS17390 (3392927) | 3392927..3394120 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NL406_RS17395 (3394143) | 3394143..3397292 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NL406_RS17400 (3397838) | 3397838..3398212 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NL406_RS17405 (3398238) | 3398238..3398456 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NL406_RS17410 (3398628) | 3398628..3399179 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NL406_RS17415 (3399295) | 3399295..3399765 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NL406_RS17420 (3399929) | 3399929..3401479 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NL406_RS17425 (3401521) | 3401521..3401874 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NL406_RS17435 (3402253) | 3402253..3402564 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NL406_RS17440 (3402595) | 3402595..3403167 | - | 573 | WP_101800724.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T269391 WP_001291435.1 NZ_CP116913:3398238-3398456 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT269391 WP_000344800.1 NZ_CP116913:3397838-3398212 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |