Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1904276..1904753 Replicon chromosome
Accession NZ_CP116909
Organism Staphylococcus aureus strain AATYW

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag LOY12_RS09615 Protein ID WP_000052076.1
Coordinates 1904565..1904753 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag LOY12_RS09610 Protein ID WP_001059690.1
Coordinates 1904276..1904536 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LOY12_RS09575 (1899669) 1899669..1900385 - 717 WP_000150011.1 type I 3-dehydroquinate dehydratase -
LOY12_RS09580 (1900533) 1900533..1900955 + 423 WP_000974460.1 organic hydroperoxide resistance protein -
LOY12_RS09585 (1901354) 1901354..1901848 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
LOY12_RS09590 (1902003) 1902003..1902620 + 618 WP_000255551.1 LysE/ArgO family amino acid transporter -
LOY12_RS09595 (1902693) 1902693..1903274 - 582 WP_001140693.1 histidine phosphatase family protein -
LOY12_RS09600 (1903499) 1903499..1903735 + 237 WP_000349581.1 hypothetical protein -
LOY12_RS09605 (1903732) 1903732..1903935 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
LOY12_RS09610 (1904276) 1904276..1904536 + 261 WP_001059690.1 hypothetical protein Antitoxin
LOY12_RS09615 (1904565) 1904565..1904753 + 189 WP_000052076.1 hypothetical protein Toxin
LOY12_RS09620 (1904941) 1904941..1905510 + 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
LOY12_RS09625 (1905598) 1905598..1905882 + 285 WP_001004399.1 hypothetical protein -
LOY12_RS09630 (1905944) 1905944..1906162 + 219 WP_000005886.1 hypothetical protein -
LOY12_RS09635 (1906654) 1906654..1906854 - 201 WP_001059082.1 cold-shock protein -
LOY12_RS09640 (1907211) 1907211..1907897 - 687 WP_000141557.1 thermonuclease family protein -
LOY12_RS09645 (1908238) 1908238..1908759 - 522 WP_000824482.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T269378 WP_000052076.1 NZ_CP116909:1904565-1904753 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT269378 WP_001059690.1 NZ_CP116909:1904276-1904536 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References