Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 872944..873720 | Replicon | chromosome |
Accession | NZ_CP116909 | ||
Organism | Staphylococcus aureus strain AATYW |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | LOY12_RS04675 | Protein ID | WP_000031108.1 |
Coordinates | 873568..873720 (+) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | LOY12_RS04670 | Protein ID | WP_001251224.1 |
Coordinates | 872944..873543 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LOY12_RS04650 (868860) | 868860..870317 | + | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
LOY12_RS04655 (870310) | 870310..871032 | + | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
LOY12_RS04660 (871183) | 871183..872310 | + | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
LOY12_RS04665 (872315) | 872315..872785 | + | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
LOY12_RS04670 (872944) | 872944..873543 | + | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
LOY12_RS04675 (873568) | 873568..873720 | + | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
LOY12_RS04680 (874268) | 874268..874663 | + | 396 | WP_000901023.1 | hypothetical protein | - |
LOY12_RS04685 (874859) | 874859..876244 | + | 1386 | WP_016170518.1 | class II fumarate hydratase | - |
LOY12_RS04690 (876697) | 876697..877518 | - | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T269376 WP_000031108.1 NZ_CP116909:873568-873720 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT269376 WP_001251224.1 NZ_CP116909:872944-873543 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|