Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 660846..661375 | Replicon | chromosome |
Accession | NZ_CP116909 | ||
Organism | Staphylococcus aureus strain AATYW |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | LOY12_RS03285 | Protein ID | WP_000621175.1 |
Coordinates | 661013..661375 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | LOY12_RS03280 | Protein ID | WP_000948331.1 |
Coordinates | 660846..661016 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LOY12_RS03250 (655883) | 655883..656443 | + | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
LOY12_RS03255 (656651) | 656651..657130 | + | 480 | WP_001287087.1 | hypothetical protein | - |
LOY12_RS03260 (657123) | 657123..658706 | + | 1584 | WP_001294626.1 | PH domain-containing protein | - |
LOY12_RS03265 (658693) | 658693..659184 | + | 492 | WP_001205912.1 | PH domain-containing protein | - |
LOY12_RS03270 (659188) | 659188..659547 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
LOY12_RS03275 (659613) | 659613..660761 | + | 1149 | WP_054194470.1 | alanine racemase | - |
LOY12_RS03280 (660846) | 660846..661016 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
LOY12_RS03285 (661013) | 661013..661375 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
LOY12_RS03290 (661725) | 661725..662726 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
LOY12_RS03295 (662845) | 662845..663171 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
LOY12_RS03300 (663173) | 663173..663652 | + | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
LOY12_RS03305 (663627) | 663627..664397 | + | 771 | WP_001041111.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T269371 WP_000621175.1 NZ_CP116909:661013-661375 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|