269363

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 4008..4482 Replicon plasmid pKP2722-5
Accession NZ_CP116908
Organism Klebsiella pneumoniae strain KP2722

Toxin (Protein)


Gene name pasB Uniprot ID A0A8J3DT22
Locus tag PO783_RS30470 Protein ID WP_004197762.1
Coordinates 4216..4482 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID S1EJF5
Locus tag PO783_RS30465 Protein ID WP_000879771.1
Coordinates 4008..4232 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PO783_RS30440 (PO783_30440) 1425..1601 + 177 WP_004197757.1 hypothetical protein -
PO783_RS30445 (PO783_30445) 1591..1935 + 345 WP_062955149.1 MobC family plasmid mobilization relaxosome protein -
PO783_RS30450 (PO783_30450) 2144..2578 + 435 Protein_3 relaxase/mobilization nuclease domain-containing protein -
PO783_RS30455 (PO783_30455) 2613..3122 + 510 WP_032433972.1 MbeB family mobilization protein -
PO783_RS30460 (PO783_30460) 3129..3341 + 213 WP_021527181.1 MbeD family mobilization/exclusion protein -
PO783_RS30465 (PO783_30465) 4008..4232 + 225 WP_000879771.1 DUF6290 family protein Antitoxin
PO783_RS30470 (PO783_30470) 4216..4482 + 267 WP_004197762.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PO783_RS30475 (PO783_30475) 4552..4902 - 351 WP_004197756.1 hypothetical protein -
PO783_RS30480 (PO783_30480) 4968..5513 - 546 WP_023317533.1 hypothetical protein -
PO783_RS30485 (PO783_30485) 5539..5865 - 327 WP_050516389.1 hypothetical protein -
PO783_RS30490 (PO783_30490) 7021..7197 + 177 WP_004197757.1 hypothetical protein -
PO783_RS30495 (PO783_30495) 7187..7531 + 345 WP_062955149.1 MobC family plasmid mobilization relaxosome protein -
PO783_RS30500 (PO783_30500) 7740..8174 + 435 Protein_13 relaxase/mobilization nuclease domain-containing protein -
PO783_RS30505 (PO783_30505) 8209..8718 + 510 WP_032433972.1 MbeB family mobilization protein -
PO783_RS30510 (PO783_30510) 8725..8937 + 213 WP_021527181.1 MbeD family mobilization/exclusion protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..11192 11192


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Relaxosome protein TraY

(4-45)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10342.96 Da        Isoelectric Point: 9.8727

>T269363 WP_004197762.1 NZ_CP116908:4216-4482 [Klebsiella pneumoniae]
MVWTINYSDRALKSLRKMDKQNARRIVDFMSLRIAVAADPRQSGKPLKGELGEFWRYRVGDYRVLCEIRDDELVILAATI
GHRREVYD

Download         Length: 267 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8369.28 Da        Isoelectric Point: 4.6533

>AT269363 WP_000879771.1 NZ_CP116908:4008-4232 [Klebsiella pneumoniae]
MLAIRLSDEIESRLDSLAKQTGRTKTFYAREAILAHLEDLEDYYLSAETAARVRRGDEAVHSSEDVRKSLGLDD

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB S1EJF5

References