Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 9751..10331 | Replicon | plasmid pKP2722-4 |
Accession | NZ_CP116907 | ||
Organism | Klebsiella pneumoniae strain KP2722 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | PO783_RS30340 | Protein ID | WP_071177730.1 |
Coordinates | 9751..10065 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | PO783_RS30345 | Protein ID | WP_000093040.1 |
Coordinates | 10053..10331 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO783_RS30315 (PO783_30315) | 5695..7659 | + | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
PO783_RS30320 (PO783_30320) | 7659..8390 | + | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
PO783_RS30325 (PO783_30325) | 8397..8927 | + | 531 | WP_071177729.1 | hypothetical protein | - |
PO783_RS30330 (PO783_30330) | 8954..9133 | - | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
PO783_RS30335 (PO783_30335) | 9159..9587 | - | 429 | WP_001140599.1 | hypothetical protein | - |
PO783_RS30340 (PO783_30340) | 9751..10065 | - | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PO783_RS30345 (PO783_30345) | 10053..10331 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PO783_RS30350 (PO783_30350) | 10506..10871 | - | 366 | WP_072354022.1 | TonB family protein | - |
PO783_RS30355 (PO783_30355) | 10868..11239 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
PO783_RS30360 (PO783_30360) | 11513..11758 | - | 246 | WP_032440458.1 | hypothetical protein | - |
PO783_RS30365 (PO783_30365) | 12403..13890 | + | 1488 | WP_004178082.1 | group II intron reverse transcriptase/maturase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..23940 | 23940 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T269362 WP_071177730.1 NZ_CP116907:c10065-9751 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|