Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 155111..155781 | Replicon | plasmid pKP2722-1 |
| Accession | NZ_CP116904 | ||
| Organism | Klebsiella pneumoniae strain KP2722 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | PO783_RS28775 | Protein ID | WP_004213072.1 |
| Coordinates | 155338..155781 (+) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | PO783_RS28770 | Protein ID | WP_004213073.1 |
| Coordinates | 155111..155341 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO783_RS28745 (PO783_28745) | 151334..152233 | - | 900 | WP_004225022.1 | nucleotide-binding protein | - |
| PO783_RS28750 (PO783_28750) | 152223..152513 | - | 291 | WP_004213078.1 | hypothetical protein | - |
| PO783_RS28755 (PO783_28755) | 152865..153071 | + | 207 | WP_004213077.1 | hypothetical protein | - |
| PO783_RS28760 (PO783_28760) | 153061..153354 | - | 294 | WP_004213076.1 | hypothetical protein | - |
| PO783_RS28765 (PO783_28765) | 153370..154503 | - | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| PO783_RS28770 (PO783_28770) | 155111..155341 | + | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PO783_RS28775 (PO783_28775) | 155338..155781 | + | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PO783_RS28780 (PO783_28780) | 155930..156181 | + | 252 | WP_186987481.1 | hypothetical protein | - |
| PO783_RS28785 (PO783_28785) | 156204..156508 | - | 305 | Protein_171 | transposase | - |
| PO783_RS28790 (PO783_28790) | 156925..157560 | + | 636 | Protein_172 | mucoid phenotype regulator RmpA2 | - |
| PO783_RS28795 (PO783_28795) | 158078..158481 | - | 404 | Protein_173 | GAF domain-containing protein | - |
| PO783_RS28800 (PO783_28800) | 158572..159492 | - | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| PO783_RS28805 (PO783_28805) | 159541..160032 | - | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| PO783_RS28810 (PO783_28810) | 160095..160370 | - | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroN / rmpA2 / iutA / iucD / iucC / iucB / iucA | 1..181653 | 181653 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T269354 WP_004213072.1 NZ_CP116904:155338-155781 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|