269354

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 155111..155781 Replicon plasmid pKP2722-1
Accession NZ_CP116904
Organism Klebsiella pneumoniae strain KP2722

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag PO783_RS28775 Protein ID WP_004213072.1
Coordinates 155338..155781 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag PO783_RS28770 Protein ID WP_004213073.1
Coordinates 155111..155341 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PO783_RS28745 (PO783_28745) 151334..152233 - 900 WP_004225022.1 nucleotide-binding protein -
PO783_RS28750 (PO783_28750) 152223..152513 - 291 WP_004213078.1 hypothetical protein -
PO783_RS28755 (PO783_28755) 152865..153071 + 207 WP_004213077.1 hypothetical protein -
PO783_RS28760 (PO783_28760) 153061..153354 - 294 WP_004213076.1 hypothetical protein -
PO783_RS28765 (PO783_28765) 153370..154503 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
PO783_RS28770 (PO783_28770) 155111..155341 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PO783_RS28775 (PO783_28775) 155338..155781 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
PO783_RS28780 (PO783_28780) 155930..156181 + 252 WP_186987481.1 hypothetical protein -
PO783_RS28785 (PO783_28785) 156204..156508 - 305 Protein_171 transposase -
PO783_RS28790 (PO783_28790) 156925..157560 + 636 Protein_172 mucoid phenotype regulator RmpA2 -
PO783_RS28795 (PO783_28795) 158078..158481 - 404 Protein_173 GAF domain-containing protein -
PO783_RS28800 (PO783_28800) 158572..159492 - 921 WP_004213934.1 DUF1471 domain-containing protein -
PO783_RS28805 (PO783_28805) 159541..160032 - 492 WP_011251327.1 DM13 domain-containing protein -
PO783_RS28810 (PO783_28810) 160095..160370 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / rmpA2 / iutA / iucD / iucC / iucB / iucA 1..181653 181653


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T269354 WP_004213072.1 NZ_CP116904:155338-155781 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT269354 WP_004213073.1 NZ_CP116904:155111-155341 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References