Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 6977..7887 Replicon plasmid pKP2722-1
Accession NZ_CP116904
Organism Klebsiella pneumoniae strain KP2722

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag PO783_RS27975 Protein ID WP_004026354.1
Coordinates 7417..7887 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag PO783_RS27970 Protein ID WP_004026357.1
Coordinates 6977..7420 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PO783_RS27945 (PO783_27945) 2225..3187 + 963 WP_004902373.1 DEAD/DEAH box helicase -
PO783_RS27950 (PO783_27950) 3531..3752 - 222 WP_004213615.1 hypothetical protein -
PO783_RS27955 (PO783_27955) 3814..5121 - 1308 Protein_5 FepA family TonB-dependent siderophore receptor -
PO783_RS27960 (PO783_27960) 5187..6167 + 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
PO783_RS27965 (PO783_27965) 6373..6876 + 504 Protein_7 DUF4113 domain-containing protein -
PO783_RS27970 (PO783_27970) 6977..7420 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
PO783_RS27975 (PO783_27975) 7417..7887 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
PO783_RS27980 (PO783_27980) 8036..8733 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
PO783_RS27985 (PO783_27985) 8735..9184 + 450 WP_011251283.1 thioredoxin fold domain-containing protein -
PO783_RS27990 (PO783_27990) 9201..9512 + 312 WP_011251282.1 hypothetical protein -
PO783_RS27995 (PO783_27995) 9526..9867 + 342 WP_011251281.1 hypothetical protein -
PO783_RS28000 (PO783_28000) 9927..10883 + 957 WP_011251280.1 DsbA family protein -
PO783_RS28005 (PO783_28005) 11308..11748 - 441 WP_011251275.1 hypothetical protein -
PO783_RS28010 (PO783_28010) 11754..12248 - 495 WP_011251274.1 hypothetical protein -
PO783_RS28015 (PO783_28015) 12257..12571 - 315 WP_011251273.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / rmpA2 / iutA / iucD / iucC / iucB / iucA 1..181653 181653
- inside IScluster/Tn - iroN 576..14168 13592


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T269352 WP_004026354.1 NZ_CP116904:7417-7887 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT269352 WP_004026357.1 NZ_CP116904:6977-7420 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References