Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4376204..4376823 Replicon chromosome
Accession NZ_CP116903
Organism Klebsiella pneumoniae strain KP2722

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag PO783_RS21845 Protein ID WP_002892050.1
Coordinates 4376605..4376823 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag PO783_RS21840 Protein ID WP_002892066.1
Coordinates 4376204..4376578 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PO783_RS21830 (PO783_21830) 4371356..4372549 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
PO783_RS21835 (PO783_21835) 4372572..4375718 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
PO783_RS21840 (PO783_21840) 4376204..4376578 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
PO783_RS21845 (PO783_21845) 4376605..4376823 + 219 WP_002892050.1 HHA domain-containing protein Toxin
PO783_RS21850 (PO783_21850) 4376982..4377548 + 567 WP_002892030.1 maltose O-acetyltransferase -
PO783_RS21855 (PO783_21855) 4377520..4377660 - 141 WP_004147370.1 hypothetical protein -
PO783_RS21860 (PO783_21860) 4377681..4378151 + 471 WP_002892026.1 YlaC family protein -
PO783_RS21865 (PO783_21865) 4378126..4379577 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
PO783_RS21870 (PO783_21870) 4379678..4380376 + 699 WP_002892021.1 GNAT family protein -
PO783_RS21875 (PO783_21875) 4380373..4380513 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
PO783_RS21880 (PO783_21880) 4380513..4380776 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T269347 WP_002892050.1 NZ_CP116903:4376605-4376823 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT269347 WP_002892066.1 NZ_CP116903:4376204-4376578 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References