Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 3551970..3552601 | Replicon | chromosome |
Accession | NZ_CP116903 | ||
Organism | Klebsiella pneumoniae strain KP2722 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A1Q8YTV3 |
Locus tag | PO783_RS17885 | Protein ID | WP_012542177.1 |
Coordinates | 3552425..3552601 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A3Q9U6R4 |
Locus tag | PO783_RS17880 | Protein ID | WP_017898984.1 |
Coordinates | 3551970..3552377 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO783_RS17845 (PO783_17845) | 3547334..3547768 | - | 435 | WP_012542168.1 | phage terminase small subunit P27 family | - |
PO783_RS17850 (PO783_17850) | 3548016..3548447 | - | 432 | WP_023279521.1 | hypothetical protein | - |
PO783_RS17855 (PO783_17855) | 3548444..3548761 | - | 318 | WP_023279522.1 | hypothetical protein | - |
PO783_RS17860 (PO783_17860) | 3548713..3549075 | - | 363 | WP_014228901.1 | HNH endonuclease | - |
PO783_RS17865 (PO783_17865) | 3550200..3550550 | - | 351 | WP_017898986.1 | hypothetical protein | - |
PO783_RS17870 (PO783_17870) | 3550547..3551044 | - | 498 | WP_023279523.1 | lysozyme | - |
PO783_RS17875 (PO783_17875) | 3551044..3551259 | - | 216 | WP_017880269.1 | class II holin family protein | - |
PO783_RS17880 (PO783_17880) | 3551970..3552377 | - | 408 | WP_017898984.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PO783_RS17885 (PO783_17885) | 3552425..3552601 | - | 177 | WP_012542177.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PO783_RS17890 (PO783_17890) | 3552965..3554749 | + | 1785 | WP_032415155.1 | ATP-binding protein | - |
PO783_RS17895 (PO783_17895) | 3554769..3555803 | + | 1035 | WP_219071718.1 | DNA cytosine methyltransferase | - |
PO783_RS17900 (PO783_17900) | 3555828..3556169 | - | 342 | WP_017898982.1 | antiterminator Q family protein | - |
PO783_RS17905 (PO783_17905) | 3556182..3557213 | - | 1032 | WP_071058942.1 | DUF968 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3518501..3576012 | 57511 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6632.83 Da Isoelectric Point: 11.0174
>T269346 WP_012542177.1 NZ_CP116903:c3552601-3552425 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
Download Length: 177 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14959.96 Da Isoelectric Point: 4.4277
>AT269346 WP_017898984.1 NZ_CP116903:c3552377-3551970 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YTV3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Q9U6R4 |