Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB(antitoxin)
Location 3551970..3552601 Replicon chromosome
Accession NZ_CP116903
Organism Klebsiella pneumoniae strain KP2722

Toxin (Protein)


Gene name hicA Uniprot ID A0A1Q8YTV3
Locus tag PO783_RS17885 Protein ID WP_012542177.1
Coordinates 3552425..3552601 (-) Length 59 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A3Q9U6R4
Locus tag PO783_RS17880 Protein ID WP_017898984.1
Coordinates 3551970..3552377 (-) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PO783_RS17845 (PO783_17845) 3547334..3547768 - 435 WP_012542168.1 phage terminase small subunit P27 family -
PO783_RS17850 (PO783_17850) 3548016..3548447 - 432 WP_023279521.1 hypothetical protein -
PO783_RS17855 (PO783_17855) 3548444..3548761 - 318 WP_023279522.1 hypothetical protein -
PO783_RS17860 (PO783_17860) 3548713..3549075 - 363 WP_014228901.1 HNH endonuclease -
PO783_RS17865 (PO783_17865) 3550200..3550550 - 351 WP_017898986.1 hypothetical protein -
PO783_RS17870 (PO783_17870) 3550547..3551044 - 498 WP_023279523.1 lysozyme -
PO783_RS17875 (PO783_17875) 3551044..3551259 - 216 WP_017880269.1 class II holin family protein -
PO783_RS17880 (PO783_17880) 3551970..3552377 - 408 WP_017898984.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PO783_RS17885 (PO783_17885) 3552425..3552601 - 177 WP_012542177.1 type II toxin-antitoxin system HicA family toxin Toxin
PO783_RS17890 (PO783_17890) 3552965..3554749 + 1785 WP_032415155.1 ATP-binding protein -
PO783_RS17895 (PO783_17895) 3554769..3555803 + 1035 WP_219071718.1 DNA cytosine methyltransferase -
PO783_RS17900 (PO783_17900) 3555828..3556169 - 342 WP_017898982.1 antiterminator Q family protein -
PO783_RS17905 (PO783_17905) 3556182..3557213 - 1032 WP_071058942.1 DUF968 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3518501..3576012 57511


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-57)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-61)


Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6632.83 Da        Isoelectric Point: 11.0174

>T269346 WP_012542177.1 NZ_CP116903:c3552601-3552425 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK

Download         Length: 177 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 14959.96 Da        Isoelectric Point: 4.4277

>AT269346 WP_017898984.1 NZ_CP116903:c3552377-3551970 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q8YTV3

Antitoxin

Source ID Structure
AlphaFold DB A0A3Q9U6R4

References