Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemK-mazE/MazF-ParD |
| Location | 3456611..3457249 | Replicon | chromosome |
| Accession | NZ_CP116902 | ||
| Organism | Aneurinibacillus sp. B1 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | PO771_RS17225 | Protein ID | WP_096467534.1 |
| Coordinates | 3456611..3456961 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | PO771_RS17230 | Protein ID | WP_272560880.1 |
| Coordinates | 3456965..3457249 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO771_RS17195 (PO771_17195) | 3451722..3452201 | - | 480 | WP_272560874.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE | - |
| PO771_RS17200 (PO771_17200) | 3452233..3453249 | - | 1017 | WP_272560875.1 | thiamine-phosphate kinase | - |
| PO771_RS17205 (PO771_17205) | 3453246..3453719 | - | 474 | WP_272560876.1 | SprT family protein | - |
| PO771_RS17210 (PO771_17210) | 3453814..3454158 | + | 345 | WP_272560877.1 | hydrolase/acyltransferase | - |
| PO771_RS17215 (PO771_17215) | 3454232..3454351 | + | 120 | WP_272560878.1 | cortex morphogenetic protein CmpA | - |
| PO771_RS17220 (PO771_17220) | 3454375..3456528 | - | 2154 | WP_272560879.1 | Tex family protein | - |
| PO771_RS17225 (PO771_17225) | 3456611..3456961 | - | 351 | WP_096467534.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PO771_RS17230 (PO771_17230) | 3456965..3457249 | - | 285 | WP_272560880.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| PO771_RS17235 (PO771_17235) | 3457520..3458707 | - | 1188 | WP_272560881.1 | alanine racemase | - |
| PO771_RS17240 (PO771_17240) | 3458864..3459409 | + | 546 | WP_272560882.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12917.86 Da Isoelectric Point: 4.8435
>T269336 WP_096467534.1 NZ_CP116902:c3456961-3456611 [Aneurinibacillus sp. B1]
VIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKSYAFDRDSVILLEQI
RTIDKQRLTDKITHLDEEMMDRVNDALQISLGLIDF
VIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKSYAFDRDSVILLEQI
RTIDKQRLTDKITHLDEEMMDRVNDALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|