Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 31999..32524 | Replicon | plasmid pXH2172-NDM |
| Accession | NZ_CP116901 | ||
| Organism | Escherichia coli strain XH2172 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | PH219_RS23345 | Protein ID | WP_001159868.1 |
| Coordinates | 32219..32524 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A223LLB0 |
| Locus tag | PH219_RS23340 | Protein ID | WP_023909027.1 |
| Coordinates | 31999..32217 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH219_RS23325 (29734) | 29734..30867 | + | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
| PH219_RS23330 (30887) | 30887..31171 | + | 285 | WP_000642771.1 | hypothetical protein | - |
| PH219_RS23335 (31168) | 31168..31365 | - | 198 | WP_000215657.1 | hypothetical protein | - |
| PH219_RS23340 (31999) | 31999..32217 | + | 219 | WP_023909027.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| PH219_RS23345 (32219) | 32219..32524 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| PH219_RS23350 (32525) | 32525..33331 | + | 807 | WP_000016982.1 | site-specific integrase | - |
| PH219_RS23355 (34105) | 34105..34860 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| PH219_RS23360 (35448) | 35448..36614 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sul1 / tet(B) / aac(6')-Ib-cr / blaOXA-1 / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / blaNDM-5 / aadA5 / aac(3)-IId / mph(A) / dfrA12 | - | 1..103554 | 103554 | |
| - | inside | Integron | aadA8b / qacE / aadA17 / dfrA12 | - | 1..103554 | 103553 | |
| - | inside | Integron | aadA17 / qacE / dfrA12 / aadA8b | - | 1..103554 | 103553 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T269331 WP_001159868.1 NZ_CP116901:32219-32524 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|