Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 25402..26045 Replicon plasmid pXH2172-NDM
Accession NZ_CP116901
Organism Escherichia coli strain XH2172

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag PH219_RS23310 Protein ID WP_001044768.1
Coordinates 25402..25818 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag PH219_RS23315 Protein ID WP_001261287.1
Coordinates 25815..26045 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PH219_RS23295 (20706) 20706..21599 - 894 WP_001553853.1 S-4TM family putative pore-forming effector -
PH219_RS23300 (21642) 21642..22637 - 996 WP_000246636.1 hypothetical protein -
PH219_RS23305 (23102) 23102..25240 + 2139 WP_000350635.1 AAA family ATPase -
PH219_RS23310 (25402) 25402..25818 - 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
PH219_RS23315 (25815) 25815..26045 - 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PH219_RS23320 (26352) 26352..29471 + 3120 WP_023909028.1 hypothetical protein -
PH219_RS23325 (29734) 29734..30867 + 1134 WP_000545983.1 DUF3800 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sul1 / tet(B) / aac(6')-Ib-cr / blaOXA-1 / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / blaNDM-5 / aadA5 / aac(3)-IId / mph(A) / dfrA12 - 1..103554 103554
- flank IS/Tn - - 20066..20569 503
- inside Integron aadA8b / qacE / aadA17 / dfrA12 - 1..103554 103553
- inside Integron aadA17 / qacE / dfrA12 / aadA8b - 1..103554 103553


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T269330 WP_001044768.1 NZ_CP116901:c25818-25402 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT269330 WP_001261287.1 NZ_CP116901:c26045-25815 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References