Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 12800..13401 Replicon plasmid pXH2172-NDM
Accession NZ_CP116901
Organism Escherichia coli strain XH2172

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag PH219_RS23265 Protein ID WP_001216034.1
Coordinates 12800..13180 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag PH219_RS23270 Protein ID WP_001190712.1
Coordinates 13180..13401 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PH219_RS23225 (8180) 8180..8448 + 269 Protein_12 type II toxin-antitoxin system ParD family antitoxin -
PH219_RS23230 (8435) 8435..8724 + 290 Protein_13 type II toxin-antitoxin system RelE/ParE family toxin -
PH219_RS23235 (8791) 8791..8973 + 183 WP_042065278.1 hypothetical protein -
PH219_RS23240 (9094) 9094..9834 + 741 WP_001066942.1 tyrosine-type recombinase/integrase -
PH219_RS23245 (10119) 10119..11096 - 978 WP_000361610.1 RepB family plasmid replication initiator protein -
PH219_RS23250 (11892) 11892..12305 - 414 Protein_17 integrase core domain-containing protein -
PH219_RS23255 (12310) 12310..12588 - 279 Protein_18 pdcB -
PH219_RS23260 (12616) 12616..12795 - 180 WP_001513661.1 hypothetical protein -
PH219_RS23265 (12800) 12800..13180 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PH219_RS23270 (13180) 13180..13401 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PH219_RS23275 (13584) 13584..15140 + 1557 WP_001553856.1 type I restriction-modification system subunit M -
PH219_RS23280 (15137) 15137..16420 + 1284 WP_001617890.1 restriction endonuclease subunit S -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sul1 / tet(B) / aac(6')-Ib-cr / blaOXA-1 / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / blaNDM-5 / aadA5 / aac(3)-IId / mph(A) / dfrA12 - 1..103554 103554
- flank IS/Tn - - 11892..12266 374
- inside Integron aadA8b / qacE / aadA17 / dfrA12 - 1..103554 103553
- inside Integron aadA17 / qacE / dfrA12 / aadA8b - 1..103554 103553


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T269329 WP_001216034.1 NZ_CP116901:c13180-12800 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT269329 WP_001190712.1 NZ_CP116901:c13401-13180 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References