Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2745501..2746126 | Replicon | chromosome |
| Accession | NZ_CP116900 | ||
| Organism | Escherichia coli strain XH2172 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PH219_RS13220 | Protein ID | WP_000911330.1 |
| Coordinates | 2745728..2746126 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | PH219_RS13215 | Protein ID | WP_000450524.1 |
| Coordinates | 2745501..2745728 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH219_RS13190 (2741304) | 2741304..2741774 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| PH219_RS13195 (2741774) | 2741774..2742346 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| PH219_RS13200 (2742492) | 2742492..2743370 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| PH219_RS13205 (2743387) | 2743387..2744421 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| PH219_RS13210 (2744634) | 2744634..2745347 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| PH219_RS13215 (2745501) | 2745501..2745728 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PH219_RS13220 (2745728) | 2745728..2746126 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PH219_RS13225 (2746273) | 2746273..2747136 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
| PH219_RS13230 (2747151) | 2747151..2749166 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| PH219_RS13235 (2749240) | 2749240..2749581 | + | 342 | Protein_2571 | esterase | - |
| PH219_RS13240 (2749663) | 2749663..2750409 | - | 747 | WP_053906593.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T269320 WP_000911330.1 NZ_CP116900:2745728-2746126 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|