Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 1741265..1742065 | Replicon | chromosome |
| Accession | NZ_CP116900 | ||
| Organism | Escherichia coli strain XH2172 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | F4NNI0 |
| Locus tag | PH219_RS08260 | Protein ID | WP_000342449.1 |
| Coordinates | 1741538..1742065 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4NNI1 |
| Locus tag | PH219_RS08255 | Protein ID | WP_001277108.1 |
| Coordinates | 1741265..1741531 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH219_RS08235 (1736922) | 1736922..1737590 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
| PH219_RS08240 (1737583) | 1737583..1738641 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
| PH219_RS08245 (1738886) | 1738886..1739740 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| PH219_RS08250 (1740012) | 1740012..1741115 | + | 1104 | WP_001350438.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| PH219_RS08255 (1741265) | 1741265..1741531 | + | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| PH219_RS08260 (1741538) | 1741538..1742065 | + | 528 | WP_000342449.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| PH219_RS08265 (1742062) | 1742062..1742445 | - | 384 | WP_000778781.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| PH219_RS08270 (1742869) | 1742869..1743978 | + | 1110 | WP_000827696.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| PH219_RS08275 (1744026) | 1744026..1744952 | + | 927 | WP_000003004.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| PH219_RS08280 (1744949) | 1744949..1746226 | + | 1278 | WP_000803799.1 | branched chain amino acid ABC transporter permease LivM | - |
| PH219_RS08285 (1746223) | 1746223..1746990 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19691.70 Da Isoelectric Point: 7.7457
>T269314 WP_000342449.1 NZ_CP116900:1741538-1742065 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLZ4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6GTS | |
| PDB | 6AJN | |
| PDB | 6GTQ | |
| PDB | 6GTO | |
| PDB | 6GTR | |
| PDB | 6AJM | |
| AlphaFold DB | A0A829CN24 |