Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1450349..1451150 Replicon chromosome
Accession NZ_CP116900
Organism Escherichia coli strain XH2172

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0E0XS49
Locus tag PH219_RS06915 Protein ID WP_001094437.1
Coordinates 1450349..1450726 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0E0XTQ1
Locus tag PH219_RS06920 Protein ID WP_001390338.1
Coordinates 1450773..1451150 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PH219_RS06885 (1445707) 1445707..1446630 - 924 WP_000535960.1 carboxylate/amino acid/amine transporter -
PH219_RS06890 (1446741) 1446741..1447925 - 1185 WP_001172877.1 sugar efflux transporter -
PH219_RS06895 (1448355) 1448355..1448483 - 129 Protein_1333 RhuM family protein -
PH219_RS06900 (1448718) 1448718..1449562 - 845 Protein_1334 DUF4942 domain-containing protein -
PH219_RS06905 (1449647) 1449647..1449844 - 198 WP_000772032.1 DUF957 domain-containing protein -
PH219_RS06910 (1449864) 1449864..1450352 - 489 WP_000761716.1 DUF5983 family protein -
PH219_RS06915 (1450349) 1450349..1450726 - 378 WP_001094437.1 TA system toxin CbtA family protein Toxin
PH219_RS06920 (1450773) 1450773..1451150 - 378 WP_001390338.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PH219_RS06925 (1451313) 1451313..1451534 - 222 WP_000692345.1 DUF987 domain-containing protein -
PH219_RS06930 (1451597) 1451597..1452073 - 477 WP_001186747.1 RadC family protein -
PH219_RS06935 (1452089) 1452089..1452259 - 171 Protein_1341 antirestriction protein -
PH219_RS06940 (1452261) 1452261..1453024 - 764 Protein_1342 ESPR-type extended signal peptide-containing protein -
PH219_RS06945 (1453396) 1453396..1454160 - 765 WP_162869019.1 GTPase family protein -
PH219_RS06950 (1454550) 1454550..1454761 + 212 Protein_1344 hemolysin expression modulator Hha -
PH219_RS06955 (1455104) 1455104..1455301 - 198 WP_001545803.1 hypothetical protein -
PH219_RS06960 (1455505) 1455505..1456074 + 570 WP_000148641.1 inovirus Gp2 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13986.90 Da        Isoelectric Point: 7.3223

>T269312 WP_001094437.1 NZ_CP116900:c1450726-1450349 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13745.44 Da        Isoelectric Point: 5.0463

>AT269312 WP_001390338.1 NZ_CP116900:c1451150-1450773 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPAEPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0XS49

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0XTQ1

References