Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 150449..151067 | Replicon | chromosome |
| Accession | NZ_CP116900 | ||
| Organism | Escherichia coli strain XH2172 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | PH219_RS00690 | Protein ID | WP_001291435.1 |
| Coordinates | 150849..151067 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | PH219_RS00685 | Protein ID | WP_000344800.1 |
| Coordinates | 150449..150823 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH219_RS00675 (145538) | 145538..146731 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PH219_RS00680 (146754) | 146754..149903 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| PH219_RS00685 (150449) | 150449..150823 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| PH219_RS00690 (150849) | 150849..151067 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| PH219_RS00695 (151239) | 151239..151790 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
| PH219_RS00700 (151906) | 151906..152376 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| PH219_RS00705 (152540) | 152540..154090 | + | 1551 | WP_001372022.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| PH219_RS00710 (154132) | 154132..154485 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| PH219_RS00720 (154864) | 154864..155175 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| PH219_RS00725 (155206) | 155206..155778 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T269310 WP_001291435.1 NZ_CP116900:150849-151067 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT269310 WP_000344800.1 NZ_CP116900:150449-150823 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |