Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemK-mazE/MazF-ParD |
Location | 567283..567915 | Replicon | chromosome |
Accession | NZ_CP116887 | ||
Organism | Aneurinibacillus sp. Ricciae_BoGa-3 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | PP175_RS03065 | Protein ID | WP_027416684.1 |
Coordinates | 567565..567915 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PP175_RS03060 | Protein ID | WP_272441386.1 |
Coordinates | 567283..567561 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PP175_RS03030 (PP175_03030) | 564069..564683 | - | 615 | WP_272441383.1 | hypothetical protein | - |
PP175_RS03050 (PP175_03050) | 565385..565825 | + | 441 | WP_272441384.1 | hypothetical protein | - |
PP175_RS03055 (PP175_03055) | 565831..567003 | + | 1173 | WP_272441385.1 | alanine racemase | - |
PP175_RS03060 (PP175_03060) | 567283..567561 | + | 279 | WP_272441386.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PP175_RS03065 (PP175_03065) | 567565..567915 | + | 351 | WP_027416684.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PP175_RS03070 (PP175_03070) | 568113..570272 | + | 2160 | WP_272441387.1 | Tex family protein | - |
PP175_RS03075 (PP175_03075) | 570297..570419 | - | 123 | WP_272441388.1 | cortex morphogenetic protein CmpA | - |
PP175_RS03080 (PP175_03080) | 570509..570988 | + | 480 | WP_272441389.1 | SprT family protein | - |
PP175_RS03085 (PP175_03085) | 570972..572036 | + | 1065 | WP_272441390.1 | thiamine-phosphate kinase | - |
PP175_RS03090 (PP175_03090) | 572041..572520 | + | 480 | WP_272441391.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12929.92 Da Isoelectric Point: 4.8668
>T269303 WP_027416684.1 NZ_CP116887:567565-567915 [Aneurinibacillus sp. Ricciae_BoGa-3]
VIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKAYAFDRDSVILLEQI
RTIDKQRLTDKITHLDEEMMERVNEALQISLGLIDF
VIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKAYAFDRDSVILLEQI
RTIDKQRLTDKITHLDEEMMERVNEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|