Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-AbrB |
Location | 870440..871128 | Replicon | chromosome |
Accession | NZ_CP116886 | ||
Organism | Thermococcus kodakarensis strain TS901 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5JIF0 |
Locus tag | POG21_RS05060 | Protein ID | WP_011249949.1 |
Coordinates | 870721..871128 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | POG21_RS05055 | Protein ID | WP_232500621.1 |
Coordinates | 870440..870724 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
POG21_RS05025 (POG21_05025) | 866090..867829 | + | 1740 | WP_011249942.1 | carbon starvation protein A | - |
POG21_RS05030 (POG21_05030) | 867870..868154 | + | 285 | WP_011249943.1 | hypothetical protein | - |
POG21_RS05035 (POG21_05035) | 868166..868447 | + | 282 | WP_011249944.1 | hypothetical protein | - |
POG21_RS05040 (POG21_05040) | 868458..869453 | + | 996 | WP_011249945.1 | ArsA family ATPase | - |
POG21_RS05045 (POG21_05045) | 869443..869727 | + | 285 | WP_011249946.1 | iron-sulfur cluster assembly protein | - |
POG21_RS05050 (POG21_05050) | 869729..870382 | + | 654 | WP_011249947.1 | hypothetical protein | - |
POG21_RS05055 (POG21_05055) | 870440..870724 | + | 285 | WP_232500621.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
POG21_RS05060 (POG21_05060) | 870721..871128 | + | 408 | WP_011249949.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
POG21_RS05065 (POG21_05065) | 871131..871913 | + | 783 | WP_011249950.1 | alpha/beta hydrolase | - |
POG21_RS05070 (POG21_05070) | 872314..872547 | + | 234 | WP_011249951.1 | hypothetical protein | - |
POG21_RS05075 (POG21_05075) | 872650..873447 | + | 798 | WP_048053699.1 | hypothetical protein | - |
POG21_RS05080 (POG21_05080) | 873444..874463 | - | 1020 | WP_011249953.1 | adenylosuccinate synthetase | - |
POG21_RS05085 (POG21_05085) | 874579..874842 | + | 264 | WP_143598683.1 | hypothetical protein | - |
POG21_RS05090 (POG21_05090) | 874878..875804 | + | 927 | WP_011249955.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15693.00 Da Isoelectric Point: 4.4082
>T269302 WP_011249949.1 NZ_CP116886:870721-871128 [Thermococcus kodakarensis]
MRLLIDTNLFVYLNANIDDELAERLDRFYAELVRENEAYTNVLVLDELIHVSKRKYGVSYPETISFIEDVVLPAVRVLPI
TFEDYLTAKEIILKYHLRPSDALHAATIQNNGLQAIVSEDEDFDKLPIKRLWLEV
MRLLIDTNLFVYLNANIDDELAERLDRFYAELVRENEAYTNVLVLDELIHVSKRKYGVSYPETISFIEDVVLPAVRVLPI
TFEDYLTAKEIILKYHLRPSDALHAATIQNNGLQAIVSEDEDFDKLPIKRLWLEV
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|