Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-AbrB |
Location | 382103..382731 | Replicon | chromosome |
Accession | NZ_CP116886 | ||
Organism | Thermococcus kodakarensis strain TS901 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | POG21_RS02340 | Protein ID | WP_011249411.1 |
Coordinates | 382103..382516 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5JGA7 |
Locus tag | POG21_RS02345 | Protein ID | WP_011249412.1 |
Coordinates | 382504..382731 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
POG21_RS02315 (POG21_02315) | 377437..378636 | - | 1200 | WP_011249406.1 | type I-A CRISPR-associated protein Cas8a2/Csx9 | - |
POG21_RS02320 (POG21_02320) | 378626..379348 | - | 723 | WP_232500599.1 | type I-A CRISPR-associated protein Cas5a | - |
POG21_RS02325 (POG21_02325) | 379371..380570 | - | 1200 | WP_048053661.1 | DevR family CRISPR-associated autoregulator | - |
POG21_RS02330 (POG21_02330) | 380570..380926 | - | 357 | WP_048053662.1 | type I-A CRISPR-associated protein Csa5 | - |
POG21_RS02335 (POG21_02335) | 381110..382090 | - | 981 | WP_011249410.1 | type I-B CRISPR-associated endonuclease Cas1b | - |
POG21_RS02340 (POG21_02340) | 382103..382516 | - | 414 | WP_011249411.1 | PIN domain-containing protein | Toxin |
POG21_RS02345 (POG21_02345) | 382504..382731 | - | 228 | WP_011249412.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
POG21_RS02350 (POG21_02350) | 382788..383300 | - | 513 | WP_011249413.1 | CRISPR-associated protein Cas4 | - |
POG21_RS02355 (POG21_02355) | 383290..384399 | - | 1110 | WP_011249414.1 | ATP-binding protein | - |
POG21_RS02360 (POG21_02360) | 384460..386682 | - | 2223 | WP_011249415.1 | CRISPR-associated helicase/endonuclease Cas3 | - |
POG21_RS02365 (POG21_02365) | 386679..387311 | - | 633 | WP_011249416.1 | type I-B CRISPR-associated protein Cas5b | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16195.78 Da Isoelectric Point: 9.5452
>T269301 WP_011249411.1 NZ_CP116886:c382516-382103 [Thermococcus kodakarensis]
MHAVIDTNVLLYDTFEDLPFHHKARRLLDSLDRWYVPPIVLQEYVWFFRRKNLPVKLARSMLSEYLDDPRFNRLNDNGES
IVYALELIEKNSLSLSRFNDAIILYHALQRSYPLATFDKKFRKLAVKNGVEVLPAKV
MHAVIDTNVLLYDTFEDLPFHHKARRLLDSLDRWYVPPIVLQEYVWFFRRKNLPVKLARSMLSEYLDDPRFNRLNDNGES
IVYALELIEKNSLSLSRFNDAIILYHALQRSYPLATFDKKFRKLAVKNGVEVLPAKV
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|