Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-AbrB |
| Location | 870440..871128 | Replicon | chromosome |
| Accession | NZ_CP116885 | ||
| Organism | Thermococcus kodakarensis strain TS900 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q5JIF0 |
| Locus tag | POG15_RS05060 | Protein ID | WP_011249949.1 |
| Coordinates | 870721..871128 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | POG15_RS05055 | Protein ID | WP_232500621.1 |
| Coordinates | 870440..870724 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| POG15_RS05025 (POG15_05025) | 866090..867829 | + | 1740 | WP_011249942.1 | carbon starvation protein A | - |
| POG15_RS05030 (POG15_05030) | 867870..868154 | + | 285 | WP_011249943.1 | hypothetical protein | - |
| POG15_RS05035 (POG15_05035) | 868166..868447 | + | 282 | WP_011249944.1 | hypothetical protein | - |
| POG15_RS05040 (POG15_05040) | 868458..869453 | + | 996 | WP_011249945.1 | ArsA family ATPase | - |
| POG15_RS05045 (POG15_05045) | 869443..869727 | + | 285 | WP_011249946.1 | iron-sulfur cluster assembly protein | - |
| POG15_RS05050 (POG15_05050) | 869729..870382 | + | 654 | WP_011249947.1 | hypothetical protein | - |
| POG15_RS05055 (POG15_05055) | 870440..870724 | + | 285 | WP_232500621.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| POG15_RS05060 (POG15_05060) | 870721..871128 | + | 408 | WP_011249949.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| POG15_RS05065 (POG15_05065) | 871131..871913 | + | 783 | WP_011249950.1 | alpha/beta hydrolase | - |
| POG15_RS05070 (POG15_05070) | 872314..872547 | + | 234 | WP_011249951.1 | hypothetical protein | - |
| POG15_RS05075 (POG15_05075) | 872650..873447 | + | 798 | WP_048053699.1 | hypothetical protein | - |
| POG15_RS05080 (POG15_05080) | 873444..874463 | - | 1020 | WP_011249953.1 | adenylosuccinate synthetase | - |
| POG15_RS05085 (POG15_05085) | 874579..874842 | + | 264 | WP_143598683.1 | hypothetical protein | - |
| POG15_RS05090 (POG15_05090) | 874878..875804 | + | 927 | WP_011249955.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15693.00 Da Isoelectric Point: 4.4082
>T269300 WP_011249949.1 NZ_CP116885:870721-871128 [Thermococcus kodakarensis]
MRLLIDTNLFVYLNANIDDELAERLDRFYAELVRENEAYTNVLVLDELIHVSKRKYGVSYPETISFIEDVVLPAVRVLPI
TFEDYLTAKEIILKYHLRPSDALHAATIQNNGLQAIVSEDEDFDKLPIKRLWLEV
MRLLIDTNLFVYLNANIDDELAERLDRFYAELVRENEAYTNVLVLDELIHVSKRKYGVSYPETISFIEDVVLPAVRVLPI
TFEDYLTAKEIILKYHLRPSDALHAATIQNNGLQAIVSEDEDFDKLPIKRLWLEV
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|