Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1293723..1294639 | Replicon | chromosome |
Accession | NZ_CP116870 | ||
Organism | Bacillus subtilis subsp. subtilis strain Master_strain |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | PPM45_RS06750 | Protein ID | WP_003244695.1 |
Coordinates | 1293893..1294639 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | PPM45_RS06745 | Protein ID | WP_003232646.1 |
Coordinates | 1293723..1293893 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PPM45_RS06720 | 1289372..1290814 | + | 1443 | WP_003245710.1 | tagaturonate reductase | - |
PPM45_RS06725 | 1290811..1292304 | + | 1494 | WP_003245409.1 | UxaA family hydrolase | - |
PPM45_RS06730 | 1292343..1293107 | - | 765 | WP_064635417.1 | sulfite exporter TauE/SafE family protein | - |
PPM45_RS06735 | 1293143..1293463 | + | 321 | Protein_1262 | peptidoglycan-binding domain-containing protein | - |
PPM45_RS06740 | 1293500..1293637 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
PPM45_RS06745 | 1293723..1293893 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
PPM45_RS06750 | 1293893..1294639 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
PPM45_RS06755 | 1294749..1295750 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
PPM45_RS06760 | 1295763..1296380 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
PPM45_RS06765 | 1296656..1297972 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
PPM45_RS06770 | 1298361..1299311 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
PPM45_RS06775 | 1299412..1299558 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T269297 WP_003244695.1 NZ_CP116870:c1294639-1293893 [Bacillus subtilis subsp. subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|