Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 390513..391149 | Replicon | chromosome |
Accession | NZ_CP116869 | ||
Organism | Bacillus subtilis subsp. subtilis strain MGP001 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | PPM34_RS02015 | Protein ID | WP_003156187.1 |
Coordinates | 390799..391149 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | PPM34_RS02010 | Protein ID | WP_003225183.1 |
Coordinates | 390513..390794 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PPM34_RS01990 | 386872..387471 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
PPM34_RS01995 | 387566..387931 | + | 366 | WP_003234281.1 | holo-ACP synthase | - |
PPM34_RS02000 | 388097..389113 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
PPM34_RS02005 | 389228..390397 | + | 1170 | WP_003234284.1 | alanine racemase | - |
PPM34_RS02010 | 390513..390794 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
PPM34_RS02015 | 390799..391149 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PPM34_RS02020 | 391264..392088 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
PPM34_RS02025 | 392093..392458 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
PPM34_RS02030 | 392462..392863 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
PPM34_RS02035 | 392875..393882 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
PPM34_RS02040 | 393944..394273 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
PPM34_RS02045 | 394270..394752 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
PPM34_RS02050 | 394718..395506 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
PPM34_RS02055 | 395506..396105 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T269292 WP_003156187.1 NZ_CP116869:390799-391149 [Bacillus subtilis subsp. subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|