Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1163041..1163957 | Replicon | chromosome |
Accession | NZ_CP116866 | ||
Organism | Bacillus subtilis subsp. subtilis strain MGP013 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | PPM57_RS06085 | Protein ID | WP_003244695.1 |
Coordinates | 1163211..1163957 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | PPM57_RS06080 | Protein ID | WP_003232646.1 |
Coordinates | 1163041..1163211 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PPM57_RS06055 | 1158690..1160132 | + | 1443 | WP_003245710.1 | tagaturonate reductase | - |
PPM57_RS06060 | 1160129..1161622 | + | 1494 | WP_003245409.1 | UxaA family hydrolase | - |
PPM57_RS06065 | 1161661..1162425 | - | 765 | WP_064635417.1 | sulfite exporter TauE/SafE family protein | - |
PPM57_RS06070 | 1162461..1162781 | + | 321 | Protein_1129 | peptidoglycan-binding domain-containing protein | - |
PPM57_RS06075 | 1162818..1162955 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
PPM57_RS06080 | 1163041..1163211 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
PPM57_RS06085 | 1163211..1163957 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
PPM57_RS06090 | 1164067..1165068 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
PPM57_RS06095 | 1165081..1165698 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
PPM57_RS06100 | 1165974..1167290 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
PPM57_RS06105 | 1167679..1168629 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
PPM57_RS06110 | 1168730..1168876 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T269281 WP_003244695.1 NZ_CP116866:c1163957-1163211 [Bacillus subtilis subsp. subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|