Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 310696..311332 | Replicon | chromosome |
Accession | NZ_CP116862 | ||
Organism | Bacillus subtilis subsp. subtilis strain MGP029 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | PPM42_RS01590 | Protein ID | WP_003156187.1 |
Coordinates | 310982..311332 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | PPM42_RS01585 | Protein ID | WP_003225183.1 |
Coordinates | 310696..310977 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PPM42_RS01565 | 307055..307654 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
PPM42_RS01570 | 307749..308114 | + | 366 | WP_003234281.1 | holo-ACP synthase | - |
PPM42_RS01575 | 308280..309296 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
PPM42_RS01580 | 309411..310580 | + | 1170 | WP_003234284.1 | alanine racemase | - |
PPM42_RS01585 | 310696..310977 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
PPM42_RS01590 | 310982..311332 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PPM42_RS01595 | 311447..312271 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
PPM42_RS01600 | 312276..312641 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
PPM42_RS01605 | 312645..313046 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
PPM42_RS01610 | 313058..314065 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
PPM42_RS01615 | 314127..314456 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
PPM42_RS01620 | 314453..314935 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
PPM42_RS01625 | 314901..315689 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
PPM42_RS01630 | 315689..316288 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T269264 WP_003156187.1 NZ_CP116862:310982-311332 [Bacillus subtilis subsp. subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|