Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1039385..1040301 | Replicon | chromosome |
Accession | NZ_CP116861 | ||
Organism | Bacillus subtilis subsp. subtilis strain MGP033 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | PPM39_RS05400 | Protein ID | WP_003244695.1 |
Coordinates | 1039555..1040301 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | PPM39_RS05395 | Protein ID | WP_003232646.1 |
Coordinates | 1039385..1039555 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PPM39_RS05370 | 1035034..1036476 | + | 1443 | WP_003245710.1 | tagaturonate reductase | - |
PPM39_RS05375 | 1036473..1037966 | + | 1494 | WP_003245409.1 | UxaA family hydrolase | - |
PPM39_RS05380 | 1038005..1038769 | - | 765 | WP_064635417.1 | sulfite exporter TauE/SafE family protein | - |
PPM39_RS05385 | 1038805..1039125 | + | 321 | Protein_992 | peptidoglycan-binding domain-containing protein | - |
PPM39_RS05390 | 1039162..1039299 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
PPM39_RS05395 | 1039385..1039555 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
PPM39_RS05400 | 1039555..1040301 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
PPM39_RS05405 | 1040411..1041412 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
PPM39_RS05410 | 1041425..1042042 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
PPM39_RS05415 | 1042318..1043634 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
PPM39_RS05420 | 1044023..1044973 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
PPM39_RS05425 | 1045074..1045220 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T269261 WP_003244695.1 NZ_CP116861:c1040301-1039555 [Bacillus subtilis subsp. subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|