Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 1656..2827 | Replicon | plasmid p32P1CEA3 |
Accession | NZ_CP116815 | ||
Organism | Ligilactobacillus salivarius strain P1CEA3 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | POF44_RS09940 | Protein ID | WP_279280969.1 |
Coordinates | 1931..2827 (+) | Length | 299 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | V5E259 |
Locus tag | POF44_RS09935 | Protein ID | WP_007124950.1 |
Coordinates | 1656..1928 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
POF44_RS09930 (POF44_09930) | 1..1098 | + | 1098 | WP_279280968.1 | replication initiator protein A | - |
POF44_RS09935 (POF44_09935) | 1656..1928 | + | 273 | WP_007124950.1 | epsilon-antitoxin | Antitoxin |
POF44_RS09940 (POF44_09940) | 1931..2827 | + | 897 | WP_279280969.1 | zeta toxin family protein | Toxin |
POF44_RS09945 (POF44_09945) | 2850..3125 | - | 276 | WP_279280970.1 | conjugal transfer protein TraD | - |
POF44_RS09950 (POF44_09950) | 3151..3378 | - | 228 | WP_003650129.1 | hypothetical protein | - |
POF44_RS09955 (POF44_09955) | 3654..5714 | + | 2061 | WP_279280971.1 | MobQ family relaxase | - |
POF44_RS09960 (POF44_09960) | 5689..6403 | + | 715 | Protein_6 | DNA topoisomerase | - |
POF44_RS09965 (POF44_09965) | 7027..7278 | + | 252 | WP_032811335.1 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..32196 | 32196 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 299 a.a. Molecular weight: 34448.14 Da Isoelectric Point: 6.8927
>T269259 WP_279280969.1 NZ_CP116815:1931-2827 [Ligilactobacillus salivarius]
MDELANYTDYQFAVKLQIEIEQLTKNKQAQASPKAYLLGGQPGAGKSGLHQLIKAQDPNAITIDNDTFKWLHPKYQQLEQ
KYGKDVVKYVTPFSNRMTESLIDYLSDKKFDLIIEGTLRTVEVPMATVTKLQNRGYEASLYVMAVPRIESYLGTLARYED
QFSLSPRTARATSKEAHDVVVRQLPDNLDFLYKQRLFKEIRLYDRKGNKLYSSLENLDESPKQIITEILNRKLENNTLFN
SIDSVIKKMESNQHTTTPQYLDLVEKTTELKKEISDKVQEQLKEFAEQNPDIKQPENK
MDELANYTDYQFAVKLQIEIEQLTKNKQAQASPKAYLLGGQPGAGKSGLHQLIKAQDPNAITIDNDTFKWLHPKYQQLEQ
KYGKDVVKYVTPFSNRMTESLIDYLSDKKFDLIIEGTLRTVEVPMATVTKLQNRGYEASLYVMAVPRIESYLGTLARYED
QFSLSPRTARATSKEAHDVVVRQLPDNLDFLYKQRLFKEIRLYDRKGNKLYSSLENLDESPKQIITEILNRKLENNTLFN
SIDSVIKKMESNQHTTTPQYLDLVEKTTELKKEISDKVQEQLKEFAEQNPDIKQPENK
Download Length: 897 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|